SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289805 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289805
Domain Number 1 Region: 1546-1757
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-41
Family Laminin G-like module 0.00075
Further Details:      
 
Domain Number 2 Region: 575-689
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-30
Family Cadherin 0.00084
Further Details:      
 
Domain Number 3 Region: 995-1108
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-30
Family Cadherin 0.00064
Further Details:      
 
Domain Number 4 Region: 894-1000
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-29
Family Cadherin 0.00095
Further Details:      
 
Domain Number 5 Region: 1780-1963
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-28
Family Laminin G-like module 0.0078
Further Details:      
 
Domain Number 6 Region: 683-787
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-28
Family Cadherin 0.0019
Further Details:      
 
Domain Number 7 Region: 782-897
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 458-573
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 9 Region: 356-457
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-22
Family Cadherin 0.0037
Further Details:      
 
Domain Number 10 Region: 1101-1221
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-21
Family Cadherin 0.0018
Further Details:      
 
Domain Number 11 Region: 1213-1300
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000119
Family Cadherin 0.013
Further Details:      
 
Domain Number 12 Region: 1482-1522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000258
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 2095-2135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000226
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 14 Region: 2782-3082
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000522
Family Rhodopsin-like 0.03
Further Details:      
 
Weak hits

Sequence:  FBpp0289805
Domain Number - Region: 28-111
Classification Level Classification E-value
Superfamily Cadherin-like 0.0002
Family Cadherin 0.017
Further Details:      
 
Domain Number - Region: 1970-2000
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0958
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289805   Gene: FBgn0024836   Transcript: FBtr0300578
Sequence length 3574
Comment type=protein; loc=2R:join(6594005..6595526,6595627..6602953,6603050..6604906,6605814..6605820,6607305..6607316); ID=FBpp0289805; name=stan-PB; parent=FBgn0024836,FBtr0300578; dbxref=FlyBase:FBpp0289805,REFSEQ:NP_001163113,GB_protein:ACZ94388,FlyBase_Annotation_IDs:CG11895-PB,FlyMine:FBpp0289805,modMine:FBpp0289805; MD5=aad78efd3b2a9cbf740715507347c252; length=3574; release=r5.30; species=Dmel;
Sequence
MQTREFPQRPLGLLLVLLVVLLQSSLIKSYLIIVHEDTPPGTVIFNASVYKLGSERHYKI
NAHKSANFVHHLVSVNHKDGQIQLRKALKCDGIYYPNLFTFYVDSTSNRLRSIDYYSLPV
RIFVSGHSCNEDRRIEQELHHHHYEEEDNTGYSKRRRRRSTQEMIQLNGNQLEEVFRQNS
TEFRAGDLIFGDSFDNEMRHRILSRKRRAVGSPDPLHLQPALHRRISDAKQWISETYASY
AIHTTDKWNQICLRRSQFINSLNAFLPRSVCQHCKVSFLDVNDERFAIEHQSRDLVASRD
VCIAESMWKVSITFNIRCDRRDIVDSDHRLKIVYHHQEFNDTDIARRVRRELRNQSPYFE
QALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSA
SLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVG
STVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET
SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTED
NTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIR
AQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGA
NAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSV
VITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRF
AITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENA
PYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIV
TNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDA
LVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFH
LTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDP
DEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPL
RNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRILSG
NNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVRLITEDMLFN
SVTVRLNEMTEEAFLSPLLNFFLDGLAAIIPCPKEHIFVFSIQDDTDVSSRILNVSFSAR
RPDVSHEEFYTPQYLQERVYLNRAILARLATVEVLPFDDNLCVREPCLNFEECLTVLKFG
NASEFIHSDTVLFRPIYPVNTFACSCPEGFTGSKEHYLCDTEVDLCYSDPCQNGGTCVRR
EGGYTCVCPSTHTGQNCETGVGHLRPCPSETCEGGLSCLSNYPSSQPPPYTATCELRARA
FGRNSFLTFESLKQRHRFNLKLRFATVQENGLLLYNGRYNELHDFIALEIHEGHVSFSFS
LGDHSERISVIQEAKVSDGKWHQVEVVYLNRSVTLVLDNCDTAIALSGQLGDRWSCANRT
TLKLDKRCSLLTETCHRFLDLTGPLQVGGLPRIPAHFPVTNRDFVGCISDLRIDDRFVDL
NSYVADNGTLAGCPQKAPLCQSEPCFNGGTCREGWGTYSCECPEGYAGNSCQDNIPAPWR
FSGDGSLSFNPLLRPIQLPWTTSFSLRTRQKEAFLLQIQIGQNSSAAVCLRQGVLYYIFD
GEPMYLAGAFLSDGEWHRVEIRWQQGSEIHFSVDYGQRSGSVPMSQKVQGLYVGKIVMGS
PDGSIGAVPEASPFEGCIQDVRIGAGQSVLSRPTIRENVEDGCESRAQCPDHCPNHSSCQ
SSWDLSTCECDSGYVGTDCAPICTVRPCASGVCRANTSLPRGYDCECNSSSRHGDYCEKE
LQQPCPGGWWGERVCGPCRCDLAQGYHPDCNKTTGQCYCKTNHYQPPNETACLSCDCYSI
GSFSGACNPLTGQCECREGVIGRRCDSCSNPYAEVTLSGCEVVYDACPRSFAGGVWWPRT
PLGGVAIEGCPPPARGKGQRSCDVQSGSWNTPDMYNCTSEPFVELRRQLSQLEKLELELN
SFVAIKMAEQLRKACEAVDRRGASKDQKISGNGRPNRRYKMESSFLLSNGGNVWSHELEM
DYLSDELKFTHDRLYGADLLVTEGLLQELINYELMQSGLNLSHSQDKYFIKNLVDAASVI
LDRKYEAEWRRATELIQRGPDDLVDAFNKYLVVLARSQHDTYTSPFEIVQPNMALGLDIV
TTESLFGYEPEQLSEYHRSKYLKPNAFTTESVVLPDTSGFLQHSARQRPVISFPKYNNYI
LDRRKFDQHTKVLVPLEMLGITPPESDEISQSGRRGSSHDHRAIVAYAQYKDVGQLLPDL
YDETITRRWGVDVELATPILSLQILVPSMEREQETQRLEIPSRKIFSSSSPSSSSSSGST
EQQFVEVFDVPKAPTSSSEQQIEDIRITAHEIPPPVSSVEQQEASSDEDGEEREPHIRLN
LDDIEFHGNSGEEVISPDSPEMLNPNYEGVSSTGSDEQPKGENEAVYRDRRLVKRQVEIT
YPSEQMQQTEQVVYRSLGSPHLAQPIKLQMWLDVDSARFGPRSNPQCVRWNSFTNQWTRL
GCQTEIPDFDGDFNPAAQQAILVNCSCTHISSYAVIVDVIDPEDIPEPSLLVQITSYSAF
LVSLPLLLGVLLALALLRGQQTNSNTIHQNIVLCVFCAELLFFVGMQSRRQLLESEFPCK
LTAICLHYFWLAAFAWTTVDCVHLYRMLTEMRDINHGPMGFYFAMGYGAPAIVVGLSVGV
RAHEYGNSLFCWLSVYEPVVWWLVGPIAGMSVVNLLILFVSVKAAFTLKDHVLGFGNLRT
LLWLSVVSLPLMGVMWVLAVLAASEHSQLLSLLLSGVVLLHALFCLIGYCIINKRVRENL
QRTCLRCMGRKVPLLDSSMVVSNSSHNVNAAARPSNFLASGYDTTTRRNIGISASSTTSR
STAKTSSSPYSDGQLRQTSTSTSNYNSASDAPSFLRGFESSTTGRSRGGEEKPSRRQRKD
SDSGSETDGRSLELASSHSSDDDESRTARSSGTHRSTAVSSTPAYLPNITEHVQATTPPE
LNVVQSPQLFPSVNKPVYAPRWSSQLPDAYLQSPPNIGRWSQDTGSDNEHVHGQAKMTIS
PNPLPNPDLTDTSYLQQHHNKINMPPSILENIRDAREGYEDSLYGRRGEYPDKYGSYKPP
SHYGSEKDYPGGGSGSQTIGHMRSFHPDAAYLSDNIYDKQRTLGSGYLGAKSESPYLSKD
RITPDIYGSRDGHYSLKRQPAYATDSLHSVHSLLKNDYHQQQQQQQQHHLQDRLSEGSDK
NGYHFPYTAEEDHLPARKLSHTQPPSLHGSQLMQPPGVGLVNDVNNPGLMGRHTLNGGSR
HSSRASSPPSTMVAPMQPLGPLTSITDTDSEAEY
Download sequence
Identical sequences E1JH30
NP_001163113.1.81976 NP_001246257.1.81976 FBpp0289805 FBpp0289805 FBpp0293438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]