SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290077 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290077
Domain Number 1 Region: 23-72,356-419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000108
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290077   Gene: FBgn0260430   Transcript: FBtr0300854
Sequence length 419
Comment type=protein; loc=3L:complement(3188211..3188331,3188389..3189241,3189336..3189384,3189442..3189654,3189709..3189732); ID=FBpp0290077; name=CG42525-PA; parent=FBgn0260430,FBtr0300854; dbxref=REFSEQ:NP_001163335,GB_protein:ACZ94607,FlyBase:FBpp0290077,FlyBase_Annotation_IDs:CG42525-PA,FlyMine:FBpp0290077,modMine:FBpp0290077; MD5=6ad3405d4cb15a9c9801bec12cf4cafc; length=419; release=r5.30; species=Dmel;
Sequence
MPAQISLKVLLLLWISNGALGQSGCSDCSLTNGQYACVSETVYGFCFDQGTVDESAIQSC
RDGYYCVLDGICAPMASAEPACVTVTSTATTDIVTDSSTLETTESTATTTAETTDSTVTE
ILTTQFTTDSTTSEFSTDSSTDSTTSELTTESSTDSTTSEISTESSTDSTTSEISTESST
DSTTSEISTESSTDSTTSEISTESSTDSTTSEISTESSTDSTTSEFSTESSTDSTTSEIS
TESSTHSTTSAISTESSTDSTTSAISTESSTDSTTSEISTESSTDSTTSAISTESSTDST
TSEVTTNSSTESTTSELTTDSSTDSTTSATTTDSSTSPTTTEPSTSVQTTVPSEIDPNAY
CAKLKSKGYFRVETDTTCQMYVYCYKLSQDYLGWLYYCNTNEYYNSDTESCQSTRPSNC
Download sequence
Identical sequences E1JIC1
FBpp0290077 FBpp0290077 NP_001163335.1.81976 FBpp0290077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]