SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290357 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290357
Domain Number 1 Region: 1583-1838
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 6.15e-75
Family Rap/Ran-GAP 0.0002
Further Details:      
 
Domain Number 2 Region: 863-1107,1139-1252,1290-1311
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000177
Family PBS lyase HEAT-like repeat 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290357   Gene: FBgn0039466   Transcript: FBtr0301134
Sequence length 1964
Comment type=protein; loc=3R:join(22793166..22793271,22795407..22795517,22796049..22796066,22796374..22796545,22796605..22797571,22797632..22801698,22801755..22801951,22802011..22802267); ID=FBpp0290357; name=CG5521-PB; parent=FBgn0039466,FBtr0301134; dbxref=REFSEQ:NP_001163748,GB_protein:ACZ95042,FlyBase:FBpp0290357,FlyBase_Annotation_IDs:CG5521-PB,FlyMine:FBpp0290357,modMine:FBpp0290357; MD5=eb54e74550ae1803064974cd913a8c05; length=1964; release=r5.30; species=Dmel;
Sequence
MFTKKSHADVKKSTAKLQDSKKDSASRLRHLRMILDNVELEESKCLFETNYSHVYFILYD
TFIQAEANLKQKELPFHIVHKAHREELDGSLWLLEKILCLLPELLARRWQCHSLSRIMAK
LLHLGNSPKLRREGVRYFLLWYQTLGENAPGYVHAMYADLIPGLIVPQKGVVGPDTEFSA
SDFLTHPNMKADGGMASVFHDNAFSHPVQSSEVVALLPPSSSEKSAPPDPRDGLEVLLNS
MVHTAACLRWRDNRAQKDHRAFAFLLQRFMDVFLPVFSPNFDVSCSIYNPRLDLPVMRSI
NKKEEVMASCVVVLINWVSRFTHERLLSHRLDCTLHIEDVDQVRLHGYQQGLIVRDVLYV
NRENINFVHEVYRQAFLLNFTSKPQIEAIRTAIAVYRDWMTGETPPPFLLEPNDDPPPPS
NAGGTPRSQRLRTPSYVGAIAGSKDQLVVRAGRQNVLQVFVTNAANVFLVNTANLNICFP
TRSRSYRSTPLEEQTEICKKVLNVYRTMVMNTEMDTRTWEQLLMVLLQVTSIVLHQNQHT
LPSGTNKSATLGGILGSAIFQTLIVTWIRAHTKVPVNVLLWEKFLNVLQSLTHREELIIE
WNKTIQTLTRVFSRYTYGINLLDLPLDRVAESRAEKRRRIGSVWQGSGSNSAANGGSAAS
AAISQNRQRESLAESSSSRSEETSSQVPLPNHPRPHHQHTQSQGGTGHGTRPIPLTPMLS
RSYSEGSLASAARSSRIRRRRAATPKPKALQPSQLAENRINPQDLRRAMSLDSLARKGDA
EETDSYQEGDNESGAGSRSPSPTASSGIEGGSIKDAQLQIDASLDDANSGSYGSGSNSGS
ISGRRCIILGGSAEGWHPDSTSIMWKRMLGALGDVNRIPKADLHAQVFMHLLEMTQNLIK
IKQNQGISTDNQNTQPMPPLVPPIGIVAPWCYGSLSLDRSFKKGKLWALQLLCSLAIQGA
VNMQQLPLFYHALHQLLTGEDRDLIYAILKHLEGPRLLSLLLPGHTLLLLDLVHASAILL
TSLEVSRSTPRAEVAALLGSLLCYPSSLLTRSVLQPTPQKFELMECSDLQDHILNIVLRC
ARREPSAKARCIALSQLGQWLLMRLSQPLPASNSGRANLFQQAVPHHKDVHPKASSVYNP
RIKEVLQVLLQALQFKHHTIAIVAVDSLKLCAERGRQLAAIERVPQLIITAICKALEIQS
VTKPKDSDKVVLTSLMLCLGEFCMAIPAPIMLTPFNEQGDTLVLQVLRVLLQVASGAPRH
ERVKLTADDDFDMHIAHDDLQGDGRLPEATYQTSETIQKCITAIKLCAKAVSMHLVTHIG
HFPMGIGASRLSSMVEEQDDIGNAAYGGQVETRRDSVELPSVVSAQNMQLFMLNSGLVAS
FIELPTLKLPGGGITAGLVTADKQVRVLMRDLNGKACWDASILYSEPRNAEEPPKTTPKI
QHSQPLDSMATSMVTHTPSPRHTLRHRPAGVLPLAKDMAPDLDQLDDMLAYIGHTSPECV
APTVSQLNAPTASPLSGNQEAQAISVILNQRLLEQEFVTHSTQAPSPALRHASSNSSLQQ
PDQRSLHSTTASFDSLPTRTEMPFQYCRLLFSHLGLAGWERRSRTHLLQRSEKLMRELRN
VDLQKCRETHKMAVIYVAAGQEDKGSILRNTSGSSTYEMFVSALGWEIDLETHNGFLGGL
PRQGCGATAPYYATPFLEVVYHVATRMPSDSSEAMLLKTRHLGNDEVHIVWSEHNRDYRR
DILPTEFCDVLIVVYPLRNGLFRVTVNRKPEVPWFGPLANESVVSGACLATLIRATAINA
SRTKRAALPLYQQFYEERNRSLDSVSSRYKESTTFEDFASRIYNPMPLSTLGTLRESNAS
SSAAPLASALLDHNRASVKGWVQASIDSGPIMGIAPSASAGSTAAMEAATGMSSASPRGP
RKLGAPFKSVTKKHSLQHIAVGGGAGAGGDTPPESPTLPQRRFK
Download sequence
Identical sequences E1JIZ3
FBpp0290357 FBpp0290357 FBpp0290357 NP_001163748.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]