SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290374 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290374
Domain Number 1 Region: 33-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.49e-17
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Weak hits

Sequence:  FBpp0290374
Domain Number - Region: 358-409,436-490
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0275
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290374   Gene: FBgn0020880   Transcript: FBtr0301151
Sequence length 696
Comment type=protein; loc=2L:complement(7775895..7777985); ID=FBpp0290374; name=CG7179-PB; parent=FBgn0020880,FBtr0301151; dbxref=REFSEQ:NP_723315,GB_protein:AAF52554,FlyBase_Annotation_IDs:CG7179-PB,FlyBase:FBpp0290374,FlyMine:FBpp0290374,modMine:FBpp0290374; MD5=0ee91ec3bbd37fa9526736cb808b1ffe; length=696; release=r5.30; species=Dmel;
Sequence
MELPIVLLLVLSVIPFEAQGAVHDELPQCGLHGVYRQRQSLVESPNYPDNYPVNTCWDYV
VRSPYRCPTKFHIQFLDFKLELSENCSRDYLAIGLNNDGDDMEVLCGQVLGIKKYHTPDG
VLRLRFLSDDSPWTTNGGFRLLITRLACEREDLVARGLDDDEEDVDGDTVQVSAKSPPKK
LLTQHHHHHLPQQSHQPQLEPAFNYTQPNRLGFNLGLQPGLGYPGGLYPPPAGLPPQYTP
PCAPQQQQLLQQQQEQHRFLQQQQLQLQILQQQRLQQQVLQQQQLQQQVQVQHPQQLQLS
QQQQQLQQELPLISDQYQTTSFQPHAVTLKDYDAQTLQQFGGQLDLCCASSFNQNHFYLS
SPGFPRTVLNYLLPNQQRDCVFYIEKSSPNVCRLRIQFKFFDFGQNSGGSIGGSFGDGFG
GGVSGGLGGGHSGGFGGQHNCNGDFLELDGQRYCGCRSGYVHKSHWDQGRKALRMRIGQS
SSTTSNGFLLEIFQDQDSDGCRQDAGQGFGLGLQPQQPQRGLGLWPQGLQPQLGLQPQLG
LQPQLGLPPQTAQMWPLQPGYPGYISGYPLPFSATPYRTARRISYARGIDAQQPSRVVET
NSTRKEFYYFDGDEAFARSAVDDEDEDKAHLGVTTQPQSSSQSIVKPESPLVTKAFEQSS
CSFDYMEVLKLSVDTLWLTKPLCFSPLRSWFPNIFG
Download sequence
Identical sequences Q9VLX5
NP_723315.3.81976 FBpp0290374 FBpp0290374 FBpp0290374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]