SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290447 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290447
Domain Number 1 Region: 32-116,305-371,789-1052,1095-1181,1209-1310,1392-1434
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000105
Family Diap1 N-terninal region-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290447   Gene: FBgn0031985   Transcript: FBtr0301229
Sequence length 1684
Comment type=protein; loc=2L:complement(8117520..8117713,8117779..8117861,8117927..8118849,8118904..8119066,8119220..8119407,8119504..8120157,8120245..8120583,8120694..8121409,8121473..8121903,8121961..8122532,8122709..8123245,8123304..8123435,8123692..8123814); ID=FBpp0290447; name=CG8683-PB; parent=FBgn0031985,FBtr0301229; dbxref=REFSEQ:NP_001033884,GB_protein:AAF52603,FlyBase:FBpp0290447,FlyBase_Annotation_IDs:CG8683-PB,FlyMine:FBpp0290447,modMine:FBpp0290447; MD5=bcc8970ff31179a79a90edb841930ce0; length=1684; release=r5.30; species=Dmel;
Sequence
MSFVGGGGCGGQDVHKFVEALQADFKTLSLETKKKYPQIKEACEEAISKLCTAGSSQQNS
VYYTVNQILYPLVQGCETKDLKIIKFCLGMMQRLITQQVVDQKGALYITNALWTLMENNI
EEVKVLQTVTLLLTTNTVVHGDTLAKALVLCFRLHYAKNPTIVNTAGATIRQLVSLVFER
VYLEKDSVSSLQQQQSSGSPAEGEGGNQDVQTFASDAFLLFQDLVQLVNADQPYWLLGMT
EMTRTFGLELLEAVLTNFSAVFHESNDFRLLLKERVCALVIKLFSPNVKHRQLPAPSNGN
APVPAEKPYFPISMRLLRLVAILIQKYHTILVTECEIFLSLIIKFLDPDKPAWQRALALE
VIHKLVTRSSLIAFFCKSYDLKNHATNIVHDMIAAMGSYIRYSLINASAMLNGQQNGVAN
SLTAMSGSNQCGFMFRGAYLPLVATYAPGVSKAVYLEMLDKIDASNIPDSYGISVGHAIL
LDMTRSIGGVIQRTPELHPSHNTAVITEEEHKPLCLQLVNSSWSALLSAFIPLVETSIDE
ATTENILKAMQNYAALCGMLEQLQPRDAFIMAMCRASFPPHYAMSIFANTTQSDGDLRCH
TRSGSQDLSSQFINSCSGDAGDFRPQIVAVGTPLPSASLPHSVMQAPVMLTNKNLQCMRA
ILFLAHNNGGILGTSWHIVLQTLQHLVWILGLKPSTGGSLQAMPKPAVEANVGIQTAVMA
DLPVLSQMLSQLFESSQYLDDVALHHLIDALCKLSHEAMELAYANREPSLFAVAKLLETG
LVNMPRIKVLWRPLTNHLLEVCQHRHIRMREWGVEAITYLVKSALQFKHKTPLKENMELQ
TMLLSPLSELSTVLHADVRQRQLDCVLQILNTAGEILSFGWPAIIEIIGAVNEHHGEPLI
RTAFQCLQLVITDFLTVMPWRCLPLCISTAAKFGSQTQELNISLTAIGLMWNISDFFNQN
QDKLMSTQLQDVSILPDFPGTVKMPQFDKLWMCLYAKLGELCVDLRPAVRKSAGQTLFST
ISAHGSLLNPPTWQALVWQVLFPLLDNVRALSSSASNEKVDASGNILIHHSRNTAQKQWA
ETQVLTLSGVCRVFNTKRELLQMLGDFERAWSLILEFIQNAALSKNGEVSLAALKSLQEI
MYHNTAERTERALKDPQTAQEQDEEIWTIAWNIWLSIGMESTKMSTSTSAKLQQQNSNGA
ETQEDFYIPSQAFLTALIQIFPAIFQHIQVKFTAADFDKFCTVLTNAVCIPVQTDAVPYI
MSTVSDTLLTPLHDGILDCMELIQKEATKPDSHISQLIPAIFRQLLIFSKFACAPPTFQQ
SVEHKYAKSSGHYANNASVEVVSMNYIPFGEKSISICVKLYQTTATEDSVVQEQILHDIV
KALRTPLAMKYKCLSSSTWKLAISSLISVLHTGLKVARAKPQHFASLWDDLADTLDKFLF
PASVCTIEDRGLEEIVLDETIDCQVIELLRDEVLPHSHEMPHQFIMQIVVLLNKGSIHSA
SDTNICYESDWKLREIFAKTCFETLLQFSLLEDHANTNNNRLNANVLTAGAAGAGGKDFA
GRLAVTALLHRFQEVLKRFNDDERQSGKCPLPRFRLSEISFVLKAIATLVVSMKKAPASK
VNKPAWDQLIGLYPYLVDCTTTTSPEVSRSLREALLQYTDLLQAPRSCSAATSNDNVIQS
NGQE
Download sequence
Identical sequences Q9VLT1 X2J564
NP_001033884.2.81976 NP_001285739.1.81976 FBpp0290447 FBpp0290447 FBpp0290447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]