SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290500 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290500
Domain Number 1 Region: 700-982
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.93e-81
Family Protein kinases, catalytic subunit 0.00000000537
Further Details:      
 
Domain Number 2 Region: 52-226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-47
Family Ephrin receptor ligand binding domain 0.0000312
Further Details:      
 
Domain Number 3 Region: 353-593
Classification Level Classification E-value
Superfamily Fibronectin type III 3.53e-26
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 254-353,402-412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000012
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290500   Gene: FBgn0025936   Transcript: FBtr0301285
Sequence length 1005
Comment type=protein; loc=4:join(632054..632064,632139..632281,632353..632432,634241..634421,634563..635048,635662..636549,636631..636807,637930..637977,638974..639102,639162..639257,639319..639689,640263..640409,640474..640733,640880..640880); ID=FBpp0290500; name=Eph-PF; parent=FBgn0025936,FBtr0301285; dbxref=REFSEQ:NP_001162824,GB_protein:ACZ95093,FlyBase_Annotation_IDs:CG1511-PF,FlyBase:FBpp0290500,FlyMine:FBpp0290500,modMine:FBpp0290500; MD5=1600e6ac5d409fe37f0cda5546c7f0d3; length=1005; release=r5.30; species=Dmel;
Sequence
MTKSALKSAFYKNQAPISEQNRSQIVSRMSLLRTILLIIISIHFKLAHADQVVLLDTTRE
ATLEWTRYPYGPQAQTPGWVEESFTDFVKGINWRSYVVCDVAYHNVNNWLWSPFIDRGSA
NRLYIEIQFTIRDCSLFPGNALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGE
GRFNQNSDVDINTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNE
TPTGREITIIEKQNGTCVDNAEPYETPTYLCKGDGKWTILTGGCRCKAGYEPNYTNKTCT
ECPLGTFKSPEVTKCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNL
TLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNICSPNVVYNPSTDTFNE
TKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNIPLDLN
EVKTGQAEIVFTTESVLLSTVFNLRILAITNKDADLEWDKPVQSDFPLEFYEVRWFPKVE
LDAINKSALNTKETKAHIVGLLENTEYGFQVRCKTNNGFGSYSNMIYAQTLQSVGSVYDD
SVQIRFIAGAIVTGVLFLVIFIIATVYFMRSKHQDDLDKKSTNHLPLPLDYASNEVNSMD
TTPIVKKLHLNVTTPLFGNSRSYVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFG
DVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTR
SNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARN
VLVNAQLICKIADFGLSREIENASDAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGV
VLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFA
SIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFISTDL
Download sequence
Identical sequences D1YSF9
NP_001162824.1.81976 FBpp0290500 FBpp0290500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]