SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290520 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290520
Domain Number 1 Region: 106-265
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.06e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290520   Gene: FBgn0053531   Transcript: FBtr0301305
Sequence length 380
Comment type=protein; loc=2L:join(6272817..6273126,6278679..6278784,6289432..6289442,6289776..6289996,6290544..6290691,6291006..6291185,6291245..6291411); ID=FBpp0290520; name=Ddr-PB; parent=FBgn0053531,FBtr0301305; dbxref=REFSEQ:NP_001162895,GB_protein:ACZ94186,FlyBase:FBpp0290520,FlyBase_Annotation_IDs:CG33531-PB,FlyMine:FBpp0290520,modMine:FBpp0290520; MD5=a29758e8c92e3e51c3087c41c2b44dee; length=380; release=r5.30; species=Dmel;
Sequence
MPAIKLQESNSIYSRSECSPTIGVPALVESQGGEGHESRRPATNYLKSYCRIKRHGVNNS
KTLCWLTLTLILLANRFGMGTAVGTPETPAAVGSNGLLAEMPIGTCKQALGMESGAIADF
QITASSAHDMGNVGPQHARAANNNNGGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQG
RFGKGQGQEYTEAYVIEYWRPGLKKWIRWRSLQGKEVLPGNINTYSEVENVLQPSVFASK
VRLYPYSQYDRTVCLRAEIVGCAWEEGIVSYSIPKGMQRGMDIDLSDKTYDGYEEGDHYV
NGLGQLVDGQRGKDNFRADINGLGKGYEWIGWRNDTLLGRPVEIIFEFETVRNLSAVIIH
TNNMFSKDVQVNKKLNTKTN
Download sequence
Identical sequences FBpp0290520 FBpp0290520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]