SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290558 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290558
Domain Number 1 Region: 2986-3354
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.83e-98
Family Regulator of chromosome condensation RCC1 0.0051
Further Details:      
 
Domain Number 2 Region: 4048-4417
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.8e-98
Family Regulator of chromosome condensation RCC1 0.0039
Further Details:      
 
Domain Number 3 Region: 4549-4876
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.22e-83
Family Hect, E3 ligase catalytic domain 0.0001
Further Details:      
 
Domain Number 4 Region: 533-899
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.13e-66
Family Regulator of chromosome condensation RCC1 0.011
Further Details:      
 
Domain Number 5 Region: 2624-2700
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.5e-25
Family CPH domain 0.00079
Further Details:      
 
Domain Number 6 Region: 1922-1989
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 1.7e-19
Family Mib/herc2 domain 0.00018
Further Details:      
 
Domain Number 7 Region: 2804-2933
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-18
Family APC10-like 0.0094
Further Details:      
 
Domain Number 8 Region: 2483-2559
Classification Level Classification E-value
Superfamily UBA-like 0.00000133
Family UBA domain 0.013
Further Details:      
 
Weak hits

Sequence:  FBpp0290558
Domain Number - Region: 3664-3751
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000118
Family Spermadhesin, CUB domain 0.007
Further Details:      
 
Domain Number - Region: 1288-1364
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0336
Family Cytochrome b5 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290558   Gene: FBgn0031107   Transcript: FBtr0301344
Sequence length 4912
Comment type=protein; loc=X:join(20265907..20267809,20269150..20269718,20269783..20270331,20270400..20271337,20271408..20271564,20271625..20273387,20273447..20273820,20273891..20281562,20281632..20282115,20282185..20282361,20282429..20282581); ID=FBpp0290558; name=HERC2-PC; parent=FBgn0031107,FBtr0301344; dbxref=REFSEQ:NP_608388,GB_protein:AAF50913,FlyBase:FBpp0290558,FlyBase_Annotation_IDs:CG11734-PC,FlyMine:FBpp0290558,modMine:FBpp0290558; MD5=aeb7dcb8257acff11282c408887e1f9e; length=4912; release=r5.30; species=Dmel;
Sequence
MFNRQASGGAGSSGQGAGSSQTASAAPVSAGVGVGGGGGASGAAAGAGSAAGSGSGSGSG
SAAPPSHSPDLYLRPLPFLDAKWLRADLIASLRNAADGAVLWNHLIQDCELVSSPTAPLL
NARGQLSYLGDDGKHYCGAQQLKCSCCQPEYCGPLSACNCDGCRPLDSDTAIKKLTTQAA
AQQAAHLSQATDMVLSGWLWSQPPSQQARLDCQRSMISELQELALRAAGNCLSAQHLRQQ
LFIYERYFVALKRERERERKSTTSAQAVASVTTANTTIAATTANAAVESQPAEQQAEHGA
LGLARVATHAALNFSFAFLRRAWRSGEDTEMCSELLSEALASLQELPEATLFEAAVVSSL
WLEVMERSIKFLRLVALGDPMGNRCTAPLNDRHTALCLLLELGVQKGTLAATLECVVLLL
LLWEKDRAGNDNRDMPRKTGAPLQRILLRYQKIGATAKGGGIAGGEPAPVASATETFLRF
LSLPKSSAAIVDLRRAAVVIISHLDRMVQPLMPRCLLRGGQATAASSSSAPQQRIYALGW
PSLSKDQQGFSAEPTLSWSGESAGVPTLSCRFQIKQVACCETQMLILSQEGKLYTWRLAK
PEAEPLPMEEVAHDVFISIAGHCEGRHFLAIDSNHNAYSWGTGEDHRLGHGDTHARAVPT
KIAALEQHCVQSVYCGCSYSAAITCGGNLLTWGRGTYARLGHGNSDDRSLPTLVVALSDH
MVVDVALGSGDAHSLALTSEGLVFAWGDGDYGKLGNGNCNGSLQPILVESLPRVQRVFAG
SQFSVALSSEGQLYTWGKATCLGHQLVERSVQGCSVPRLVSSLQHKRIVDVAVSVAHCLA
LSSSGEVFGWGRNDSQQICPASVSSEPLLRTPILVSLPTFPASGIACTSAQSLVWTQSSH
QGVPRRAPFVVDLGEPTFRLLDQLLGMCSSQDNRQTPNQESECIAVACLNLFRLQLLALI
ANGVEPRQVGLASGSRLLCSLKTRILGLAGGSQVLRTIQVAAQQALQDGWSVLLPTAAER
AQTLTSLLPSEPGQASSAGHRFMTDLLVSSLMAEGGLESALQHAIRLESSSCSADCGDGV
HLPLLQLITRLLSNNAALSQTRLSPTLGKQQEKEEEEREQQHQEPSTSPSLSLLHRFQRL
LLSHIHQAQPEEETTGAEALLLQYMHALIPACVATLQKAHELALQCREPGENSFGQMVGH
LGRVLQADISDALLNELLVGLLLLKRDRPQCLGGLRWARLFLPLLRVLDRLNRALGEGEL
RDGDDMGWPGIICRGGPKGGPPPADPETHYVRRADMENLLLDGSRCIILAGYVCDLSGYN
CESETLRSVLDSGLGKDLTAEMSSQVHRTAMEHILEHHKLGKYMVQASTEEKSSAPGPSR
LTHFSSECALAQLLGLVANLMCSGPALQPAELQCRQLDKSSLLSGGLQLLQPSNPFDEEK
GEARSSHSCHSTAGNTPTELPPPLPMQQQLAPGRGKSQLQLRADAFISGLAEARVSEPPV
AAWLALTERYCKAHNLMWHQEFATEHPVQELERLLSAVLIRHQYLGGLVLNALETEVPPP
RQLGEIIRLVHQAKWSVVRTRQQLNRSYKEVCAPILERLRFLLYEVRPAISPQQRGLRRL
PILQRPPRFKMLVRRLLQELRSSRQPAKPEDLLNASIQQEQEKKPQSMPKQELEEQEEEE
TLLRRLNERQIHGEGELDPALMQDIVDFALQDSCDVETARRAMYCQMQRYQLRLAGLQIV
QQLLELHGLLDAAQYSLLNGFLGLHLKSTSSGGGSTGSGSSLHVLGQLNMISAYQKARLL
LAQSRVLDWAVRELRRLVNQEQQGHARGKDSTNLGTYVLLKRLPRARFLLSVFGLLAKEL
GPNELGFLINSGLLGTVLGLLAQTGGEGATGGQVHGELSILYEDSVLKQKSSKAQLSGPD
LAKLMKIGTRIVRGADWKWGDQDGNPPGEGRIISEVGEDGWVRVEWYTGATNSYRMGKEG
QYDLQLADSALNVASPTEPEREDVSGSEASPTSDSHPSKLLRHCAAKLLQILAVGTGLHG
AQLDKDALRGMTSMFRTIIYPKPSMSNISYALGWLNLGFIRAISGDCPRLCLELSTPGWL
SHYLSLLEQPAGNEAGVYRQLHCLRLLQLILAQWGAEEEPRMPALVHQLFATLGRIALHC
PGDASLLPTAEGKARVLLTASHSGSVAEELVALLRRLHTLPSWNPVINSFLAQKLCVAAE
LLAEQSHSTALDSEQVFVLGVLGAMGGHDLRPRVGLHCFHEGSHMVIASFTPKGRCLLAP
GGVGSGVGFVKVQLPAVMPHLDHTVFSLSRLPMNEMLLNAWTVLLYGPAPELRELPSSAD
GRLDLALLRAQQLQMAVLHTNGVLYRHQVALRRILKQRAPGSIYASPDEPDRSDAESQQP
GEQDQQLSSGSGQEPQLLIQCILLRATQASPVKACYSYMDLATAALNCIQSLATQAHQEL
SEGGGVPPNGRALSSPPQPTMVHGVPVYNVARKEQKPSEQVEQKSKWPAAATDAQLIGQI
MEMGFTRRTVELALKQLSLQAEIMPTPEQIVQWILEHPDVCANTIEEDTLPLASSASSHD
PEADSDNECPSSNSTTSSSTSSDTVEGQPMAVSGPAPPVKFESRKDFQTADLYALYVRGL
VRPGMTVRCCRDFEEIKQGDMGTVLIVDTEGLHDLNVQVDWRNHGSTYWVCFVHIELVEA
AQTHHQPRPPPIAVGARVRLRTSSLRYGMLCPLRLGRSQGSSAIGVVSSVRSKQLTVDFP
DQPAWQGHINEVELVASQPTSATLPSLGDSCSQMPPSDLIEDWSRCIRSLTVSSNEAAAK
HLLNGSNQPWQSCSSGPCRHWIRLELHDRILVHSLTLKVSPEDHSHMPSLLEIRVGDCVD
SLKEYTWIPVPAGASRVLLMQQVPTYYPWVEVVVKQCQNNGIQCKIHGIKFVGRRQQPDL
QHILANAQFLASEYSAGVGPGSTAGAGAVSTSHEEAAAAPEQDLPCTVMVWGLNDKEQLG
GLKGSKVKVPTFSQTISRLRPIHIAGGSKSLFIVSQDGKVYACGEGTNGRLGLGVTHNVP
LPHQLPVLRQYVVKKVAVHSGGKHALALTLDGKVFSWGEGEDGKLGHGNRTTLDKPRLVE
ALRAKKIRDVACGSSHSAAISSQGELYTWGLGEYGRLGHGDNTTQLKPKLVTALAGRRVV
QVACGSRDAQTLALTEDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGA
QFSLALTRAGEVWTWGKGDYYRLGHGGDQHVRKPQPIGGLRGRRVIHVAVGALHCLAVTD
AGQVYAWGDNDHGQQGSGNTFVNKKPALVIGLDAVFVNRVACGSSHSIAWGLPNASSDEE
KRGPVPFSSTRDPLGGSSLGIYEAETMQTLKQEAKPLNQSSLSESLALETPAARQAALGH
VLRAMSILQARQLIVAALTSHSKVNFKERGAVGGEEDHLIGGPIMGAPLQLAETIAQGGG
EAPADATDAGLQEHSPEAAVDALTGGMSGGANTLPPLSAGPLSAFQSLTGSLSMSGSLSS
SALPQHKHSRMSASAMSVMAATMTQQEEMLSHISHCHGLDDFGGLLGEPEAKSLVELLKL
AVCGRCGPPSTSQTIADTLISLGAGTPAVAAMLLETCITELEDLCTSRHCLGKLPKPVMQ
ESSHPYVDNVNVTGVVRIPGAEMLRLEFDSQCSTEKRNDPLVIMDGTGRVLAMRSGREFA
HWAPEIRVLGDELRWKFSSDSSVNGWGWRFWVHAIMPAATLGESGSDRAVLSQPSMALVM
SLLDSRLAPRQPSVLLRLASALAACSQLGALTTAQRIWSLRKLHAVLLLEQAPRPQDPSL
STLLQPLIPELLRQYEYEEPQVRGGIHLMHSDYFKTLAALACDMQLDAALPATSSSSSSS
AAPGAISSTGDVHKWAWFKRYCIAVRVAQSLIRRTELPRAFCLEVRKKFAEMLPSSSSNS
NANPGCQSPGASMLNSTTSLSSSTVSNVSPPPGITGEQPDLHCHAHQLESTSTLLHEDHT
LFQAPHDAQLLQWLNRRPDDWALSWGGASTIYGWGHNHRGQLGGLEGSRIKTPTPCEALS
LLRPVQLAGGEQSLFAVTPDGKLFATGYGSGGRLGVGGSDSWAIPTLLGSLQHVFVKKVA
VNSGGKHCLALTTEGEVYAWGEGEDGKLGHGNRMSYDRPKLVEHLNGMSVADIACGSAHS
AAITASGHVLTWGKGRYGRLGHGDSEDQLRPKLVEALLGYRAIDIACGSGDAQTLCITDD
DNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWGK
GDFHRLGHGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVYTWGDNDEGQLGD
GTVTAIQRPRLVAALQGKHIVKVTCGSAHTLALSTSQLSERLRPLPNPPLEYDLVRDLAP
EALHARLILLHHFSELVCPCLAMLPISGDLSLGALKDVLVYNIKEAAFRKVIQTTMVRDK
QHGPVIELNRIQVKRSRNRCNGLAGIDGMKSVFGQMVQKLPLLTQEALALPHRVWKVKFV
GESVDDCGGGYSESIAEMCDELQNGSVPLLINTPNGRGEAGANRDCFLLDPTLSSVLQMN
MFRFLGVLMGIAVRTGSPLSINLAEPVWRQLTGEVLRPTDLTEVDRDYVAGLLCIRNMDD
DPKLFTALELPFSTSSARGHEVPLSTRYTHISPRNRAEYVRLALGFRLHEFDEQVKAVRD
GMSKVIPVPLLSLFSAAELQAMVCGSPDIPLGLLKSVATYKGFDPSSALVTWFWEVMEEF
TNQERSLFLRFVWGRTRLPRTIADFRGRDFVLQVLEKNPPDHFLPESYTCFFLLKMPRYS
CKAVLLEKLKYAIHFCKSIDTDEYARVAMGEPTEATGSEDNSDLESVASHEG
Download sequence
Identical sequences Q9VR91
FBpp0290558 FBpp0290558 NP_608388.2.81976 FBpp0290558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]