SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290604 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290604
Domain Number 1 Region: 419-632
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-29
Family Kelch motif 0.007
Further Details:      
 
Domain Number 2 Region: 291-407
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-16
Family Kelch motif 0.0058
Further Details:      
 
Domain Number 3 Region: 83-217
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000392
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 4 Region: 949-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000276
Family Laminin-type module 0.037
Further Details:      
 
Weak hits

Sequence:  FBpp0290604
Domain Number - Region: 224-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000418
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290604   Gene: FBgn0039528   Transcript: FBtr0301390
Sequence length 1323
Comment type=protein; loc=3R:complement(23424757..23424914,23424979..23425060,23425214..23425300,23425362..23428191,23428520..23428667,23428736..23428893,23428973..23429209,23432491..23432762); ID=FBpp0290604; name=dsd-PB; parent=FBgn0039528,FBtr0301390; dbxref=REFSEQ:NP_651571,GB_protein:AAF56723,FlyBase:FBpp0290604,FlyBase_Annotation_IDs:CG5634-PB,FlyMine:FBpp0290604,modMine:FBpp0290604; MD5=157cf330febae5959727850b14ec9765; length=1323; release=r5.30; species=Dmel;
Sequence
MCLAAEPPQKQPNRSSTSPTFNAKYRRKCLLLLTLLLFHGCFSGLHRAAAFNCTAHGGRC
QNDGQCQEDGQCLCADGWQGPECQFCGGKVRMYHPMGTIHDGWGNYSVSVKCSWLIDARH
PHWNRRHNTNPSRTANIRIHLREFATECGWDHLYIYDGDSVDSPLLAVFSGLMYRGNFSI
RRVPQVIATSGTALVHFFSDDAYNMSGFNLTYKMNSCPSDSDEVECSGHGKCRDGDCICD
PMYRGEACNIAACPNNCFESKNQGHCRLDQERCSCYEGFAGDDCSQISAHGAWSTVHPKH
SPAPAGSASHGATIWRDTLHIVGGESYGRGKLMSTYDFNGNVWETVHPEDGSEVPDKRYG
ASTVMYGDKIFMYGGVVKGHGISNELWAFDVSARTWANISVRADPSCNATGGTTAMCGPL
HVVGHTATLVPGYGDKNNYQYMVVIFGHSPNYGYLNTVQEFNFASREWRIVPTTGYVVKG
GYGHSAAYDFLTEKVYVYGGIVSESESSQVLSSRLYAYEPATRVWSLLSAAPSARLLHTA
NFVNQGLMMVFGGNTHNDTSQSYGAKCYSQDLLVYDVYCDSWHYHPMPGHLQADLARFGH
SSVVFEESLYIYGGFNGQLLNDMLRYQPGYCSYYTKQEKCTAARPGVKCIWDVQKMRCIA
ITQVQRSAIYGREQYDYVACPSKSRLTLTSELLHDVHRCQELASCQSCVSTAFGCTYCGN
GVCSKERCRETTSMASVFFESSTQMAVSTASPPLNAKHLDSCPISEEYLVSSVCDQLHNC
RACSANLACRWDSEHNRCKSYTSYGGLALNRTQDEVACSPSCASLTNCQNCTEDECIWCQ
NEQRCVDRNAYTASFPYGQCREWTTFTAKCRSAPIQSTALAVGSTTALSSAQCGYYNSCQ
MCLDDPACGWCDNGSNTGLGRCVVGGALAPYDDTECALKHWFFTSCPRCNCNGHSYCNDQ
QHCEQPCNNLTTGAHCEKCRTGYWGNPINGGKCQRCDCNGQGVYCHPDTGKCFCTTKGIV
GDHCEKCDSQNHYHGDPLKGSCYYELTIDYQFTFNLSKKEDRHFTQINFRNSPGKPEIDA
DFTITCSVPAKMDISVKRAGSPDMLILVGVNCSTFRHRFPKTDYQFGHSPDDNSSLTTFY
VFVHDFQPPIWIQIAFSQYPKLNLQQFFITFSSCFLLLLLMAAVLWKIKQKYDMFRRRQR
LFVEMEQMASRPFSQVLVDIENRESIDLSLTLEGIGHLSKKRKKECPSPIALEPCSGNRA
AVLSLLVRLPTGGLSQAPSGQSAGLAVASALVTLGNPRRPSIDQHPKEPKSKRKQSQHPD
SCT
Download sequence
Identical sequences Q9VB20
FBpp0290604 NP_001263013.1.81976 NP_651571.3.81976 FBpp0290604 FBpp0290604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]