SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290681 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290681
Domain Number 1 Region: 412-671
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-50
Family YWTD domain 0.00000105
Further Details:      
 
Domain Number 2 Region: 311-403,672-720
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 28-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000864
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 4 Region: 110-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000222
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 5 Region: 231-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 66-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 150-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 285-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 192-231
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290681   Gene: FBgn0066101   Transcript: FBtr0301466
Sequence length 889
Comment type=protein; loc=3R:complement(21567702..21567734,21567876..21568037,21568114..21568247,21570088..21570264,21570406..21570604,21570702..21572114,21572729..21572955,21573825..21573947,21574992..21575111,21577783..21577864); ID=FBpp0290681; name=LpR1-PG; parent=FBgn0066101,FBtr0301466; dbxref=REFSEQ:NP_733119,GB_protein:AAF56499,FlyBase:FBpp0290681,FlyBase_Annotation_IDs:CG31094-PG,FlyMine:FBpp0290681,modMine:FBpp0290681; MD5=fcca557bca8561535fc0e86998596f25; length=889; release=r5.30; species=Dmel;
Sequence
MGRIWCLLFVSSLLHTQSQSFRVLAINEATCSSDQFRCGNGNCIPNKWRCDQESDCADGS
DEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNCNQTCRADEFTCG
NGRCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGACIAKRWVCDGDPDCSDG
SDERSCANVTKTTTPCLSHEYQCKDRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRA
DQFQCGDRSCIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDCGGGQCVP
LSKVCDKRKDCPDGEDEPAGKCGINECASKNGGCMHQCIDLKVGHHCECHEGYKLSPDKR
NCQDINECEVPGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDI
RKIALDHMEMTSIVNSTKAATALDFVFRTGMIFWSDVTTQSIYKAPIDEGNEKTVVLTKS
SVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVKDSLDIPRSIALDPIEGWMY
WSDWGASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDG
SQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPM
VVHVYHPYRQPDGVNHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMVDGLMCVE
DPLYLPPVTRPPRARKTKPRPKSPRRRLPTGVQVGHADIRIEINDDLQLSTRLPLLPTTF
VADQRPVKNHTQIEKTTTPSEQPDSGFIALVVIASLSGFAVLLSVLLLIGYRYCSKRRIN
SMNFENPIYRKTTTTEDHFSLRKNLPARIYDHTSVMDEEYSPVIGISSY
Download sequence
Identical sequences Q9VBN1
FBpp0290681 NP_733119.2.81976 FBpp0290681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]