SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290695 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290695
Domain Number 1 Region: 594-782,856-1067,1164-1405
Classification Level Classification E-value
Superfamily ARM repeat 3.46e-59
Family HEAT repeat 0.031
Further Details:      
 
Domain Number 2 Region: 16-197,273-473
Classification Level Classification E-value
Superfamily ARM repeat 1.28e-34
Family HEAT repeat 0.043
Further Details:      
 
Domain Number 3 Region: 1584-1846
Classification Level Classification E-value
Superfamily ARM repeat 0.000014
Family MIF4G domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290695   Gene: FBgn0027948   Transcript: FBtr0301480
Sequence length 2042
Comment type=protein; loc=3R:join(11877867..11878555,11878611..11878681,11878746..11879065,11879125..11881658,11881718..11881955,11882014..11882513,11883274..11883687,11883751..11883940,11884013..11884266,11884326..11884656,11884724..11884897,11884965..11885097,11885207..11885406,11885461..11885541); ID=FBpp0290695; name=msps-PC; parent=FBgn0027948,FBtr0301480; dbxref=REFSEQ:NP_732105,GB_protein:AAF55269,FlyBase:FBpp0290695,FlyBase_Annotation_IDs:CG5000-PC,FlyMine:FBpp0290695,modMine:FBpp0290695; MD5=86bc07b93e2973244ef27e73d64dc54d; length=2042; release=r5.30; species=Dmel;
Sequence
MAEDTEYKKLPVEERCVHKLWKARVDGYEEAAKIFRELDDEKSPEWSKFAGLIKKMVVDS
NALAQEKGLEAALIFVENSGLAGRTVGDVMTGIVQKCIAAPKTKTKELSVQVALMYVEIE
KQEAVVEELVKGMEAKNPKIVSACVAATTLALREFGHKVIGVKPLIKKLAPLMSDRDKTV
RDEGKQLAVEIYRWIGAAMKAQISTLPQVTLKELEDEFDKLKGERVEPSRYLKSQQEKQA
KIADAAATEDAYNEDDGEAGVEEIDPMDLLDPVDILSKMPKDFYDKLEEKKWTLRKESLE
VLEKLLTDHPKLENGEYGALVSALKKVITKDSNVVLVAMAGKCLALLAKGLAKRFSNYAS
ACVPSLLEKFKEKKPNVVTALREAIDAIYASTSLEAQQESIVESLSNKNPSVKSETALFI
ARALTRTQPTALNKKLLKLLTTSLVKTLNEPDPTVRDSSAEALGTLIKLMGDKAVTPLLA
DVDPLKMAKIKECQEKAEIKIKVAGPKKETRPASAPTAKAAAPAKTVAGSVDPKPVTRPA
TTGARKVLKKPATVSGGGATSAPTAALKAGGKPLATEREITPEELQEKSEEILPAEILNG
LVDSNWKNRLAAVEQLLGEISGFDAKQAGISQILIRTISGRKPGLKEMNFQVLKFKLDII
RSVAENYPLTTTTVDLVINEIIEKLADAKNGAAAADVLSAFAEATKLEYVVGKVLSFAFE
QKSPKVQSEAFNWVNRSIIEFGFQLQPKTLIEDVRKGVQSTNPTVRASAIQMVGTMSMYM
GKALMMFFDSEKPALKSQIQVEFDKNVGEKPPKPVRGVQRSSGGTAGNSPDNEDDDGGAA
GEEEPINMADLLPRVDIAPQITEALLKEMSDKDWKTRNEGLTKLQAIISEARLIKPSIGD
LAPALAHRLVDSNAKIAQTTLAICEQLATAMGAGCRNHVRNLFPGFLHALGDNKSFVRAA
ALNCINSFGEKGGYKEFFESEMIADALKGGSPALKTELWAWLADKLPGLPPKSVSKEDIH
SMVPHLYAHICDRNADVRKNANEAVLGIMIHLGFDAMNRALDKQKPASKKDILAALEKAR
PNLPVKPLPKGKHQAPIPEEPKLKTVRGGGAGGAPGIQKSATARVAGGQDKQVPARKKDE
DIDTSPLLCANSAKNQRLLDEQKMKVLKWTFVTPREEFTELLRDQMMTANVNKALIANMF
HDDFRYHLKVIEQLSEDLAGNSKALVCNLDLILKWLTLRFYDTNPSVLIKGLEYLVQVFQ
VLIDEEYILAENEGSSFVPHLLLKIGDPKDAVRNGVRRVLRQVILVFPFVKVFGYVMEGL
KSKNARQRTECLDELTFLIESYGMNICPQSAVREIARQISDRDNSVRNAALNCIVQVFFL
SGEKTYKMIGHLNEKDLSMLDERIKRAKKTKKPTPPPSVDVPAPQRHDSIEIEDAEVGNG
CDELPPPDEDGTFDQAPSSQLLLLQQQLQQLQQQAQQQKPSGPFGLDSQVISEIEKDWVR
VDQMEQKPLLNVDISSLDEPIKVRPTRAGIHYPQEKFDRLISRQHYMQQTLTTSPSSTAG
MTSGVSPYRSPMRLQHQQPQQQLENNIPNLADVLPKHDPQLVKVIKGVSSTDTLKARAAI
NELAAIIEAPEKQAVLRDYEEIFIQNVLAQFKNLSQIPSAQSVVVYQPLLSILYTFFHAN
ILGKTLSVACIKNLMSALLNLMADPKLAVGDDSQYNKVINGICLKVLDKVDFTNLNCALI
RLLRETCPEAKLPKFTDLLMKCIWRNVKMLPERSNELNYDAVILEVHEFMLALPSTWWQN
RPSDTPMRTIKTILHNMAKVKGNAILQHLNQIPTHSELHTYLIRILKNFQKDGSASGIGA
SPQRAKEIASKRISHQTHDTVSQIFKLISDRDTKQQGLQKLYDFKQQNPDIDLSTFLQGS
SAPFHKYIEEGLAEIERNQNAGSTQDNRTDVNYQNNGPDPDFWMDRLQYHMTGGAAKLAS
ARSADDGSHMLDNKVVDENLCLNGMNAQKASLIKREKRDMSPNRLQHLQAKLAQIKKENH
AQ
Download sequence
Identical sequences Q9VEZ3
FBpp0290695 NP_732105.2.81976 FBpp0290695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]