SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290770 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290770
Domain Number 1 Region: 1167-1297
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.57e-28
Family Synaptotagmin-like (S variant) 0.0000611
Further Details:      
 
Domain Number 2 Region: 2757-2881
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-21
Family Synaptotagmin-like (S variant) 0.0041
Further Details:      
 
Domain Number 3 Region: 8-131
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.48e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.008
Further Details:      
 
Domain Number 4 Region: 871-943
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000359
Family PDZ domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290770   Gene: FBgn0053547   Transcript: FBtr0301555
Sequence length 2908
Comment type=protein; loc=3R:complement(13702714..13702920,13702981..13703148,13703211..13703388,13704500..13704719,13705791..13705837,13706900..13707149,13707498..13707623,13707823..13710404,13711326..13711669,13711871..13712263,13713143..13713265,13715317..13715502,13716183..13716317,13716383..13716520,13716616..13717229,13717823..13718128,13718262..13718508,13719627..13720624,13727117..13727179,13730669..13731272,13731368..13731724,13731786..13731911,13733709..13733913,13734353..13734462); ID=FBpp0290770; name=Rim-PB; parent=FBgn0053547,FBtr0301555; dbxref=REFSEQ:NP_001014630,GB_protein:AAF55479,FlyBase:FBpp0290770,FlyBase_Annotation_IDs:CG33547-PB,FlyMine:FBpp0290770,modMine:FBpp0290770; MD5=10f32bd63da8b0261a0171260b3b19cb; length=2908; release=r5.30; species=Dmel;
Sequence
MDEMPDLSHLTPHERMQIENVLMRQKQEEEKQNEIMRRKQDEVVTLEMQIRQRSEQQKKA
GVELDATCHICLKTKFADGVGHICHYCNIRCCARCGGKVTLRSNKVIWVCILCRKKQELL
SKTGQWINKTAAQQDGFIRRIEPDGSSDISQHPIVDPHDTTDKRPKLERTRSAAEKENLP
MQRAGSMLRRQYSQQEQPTNRRLSASDSGMDPVMSPGQQMQHHQQQQRARMQPMNPQQAQ
QGYGMQQQQQPRSGGAYPDDDPRYYQGELDGLMRQHPHLAHPSQVQPQHTPQSHSQQQQS
QHQQQHLMPQQHRPSPQQHSQQQQQQQQHSQQFAARQQQHQQQQHQQQVQQSYHAQIHQQ
PQQHPHPHSQQQQHHQQMQHQHGQSVPQMGGYQKPPPLTRNLTISGGHAMDSSAYSQQQQ
QQQRRALAGSQYASQQQRSFSSSEEEFQHQLLAAQGAVTVTAGSDYDAPALLEGKDKHVD
FATEIRLEGGRLQVRTSLDPWRQQRSLNERDLLSSGGGGGGGVGGADFRHLSHATQRLYA
SADQRDRYELQLQHRERLEQYPLTRTARLDVQQRNSLNRSNHERQFSGGGAGVGPGGAGG
GGAAGAYRRAPPLAAAGGGGSSSSSTTSSSYYPQSKPQIVIGPGSGYDRGSGSMASMASA
AAATAADAQGQAARNSQRGGLLGATRGGGGSSSVSSTEAAYWDEPATSSSSSAAQDSRRF
TERRIKKTVRFDAHDEEASILASSSLPPVTAILPSTAVDVGAATILSSGKSLDAVGVGGA
DWSRWEAERQGSQDSATKDSGIDTSSTFTSSEDSNRGDGPKNPVNWQTSADNTRLIGHMI
LRKYYDGEDILGLKVNGGQPLATGGSVSGAGTGAAIGAGGPCGAIVEKVKRGSVADLEGR
IRPGDEILEWNGRGLHNKSADEVYDIIDESRLDAQVELIVSRPIGSGGGSGGSSANVSPI
SGASGGSANSVPARRSSANFPHSGLASSMAGSAVVSSGGRYLQRKAPAVEAIEIHRDKPS
VLITSPGSPDIHTSVSGPGSVSGSGLRQRGGVGQTQRLGPSHSTHSHSSSGSGSGSGSST
SSVHAPASAHGPVHASASASGSAPGGLHGTTTAGHHHHPHPHHYHPHQHPLPHPHQHQGP
PAAHLQGHGVGGGIGMGSGSGTTTQPIPIEGRLQLKLGYDQNTLQLIVTLVCATGLSLRQ
SGAGRNPYAKVFLLPDRSHKSKRRTKTVGTTCEPRWGQTFVYSGLRRCDLNGRLLEVTLW
DYVRYGANDFIGEVVIDLAHHILDDEAEWYQLQPHQDTSYLLRDEGSDVDGLILTPTDHL
SPPSTMSRLSDSDTTSDCDIDGMTPGASISSMGSSASPPPLLELDLNERRSRRDMSPQGR
KRVAGMVARDYRTVSGIGQSYHNQASATGYYRRGGGNGVGSAIGPGGMSLSQRSHSAAPS
DGYHSSGVGGAASGGPAYGYRSTSPRRGSLSPPDDRYIDYPVLPVHGSSPNAPSVYQGPG
GVSSAAASASQQQRFQSRSATATPTGSPKKRQLPQVPQTSRSAMLRDRLGQDFDERLASG
GRFGRHRTRQPHHQATYRSTGMGGWERHYTGLSDSDLHSMDARMRPRHSLSPDKDFMGEF
GDSDMESVVSVTSSAFSTQSERPRTSRGLSFPRNWRNLFGVRNSFLGGAGGEPITGLRLH
HSEPGRANTIEVDDCDYLPVGGAQQLVLLEQLEQLQQLAALAAADSPPISAGIGIQPPHQ
VLVTDANSGQLVEQFYVEPGTMAEEMMEPLDPHLHPHSVFYSPSPHLPPQPFDIDIDTIY
PPRRSNGLKPNVQATAAAYPLPLLPSFEQFKRITTPITNFFRSSSPAGVHPHAHDHTSTT
PSSLVGYVRDHQDKSCSHCQNGSQPVVLSTHHTLHLTAAGLAIGACQDPCCLADAHPHPQ
HQPMGYGEPPSSDPAMCGECVDQHFLGGLTGPQLNLGVVPTYHVHTPTPNAHRRARGQMA
TPAPPPTQSVLRLSRQLSEDALVAAVPISEAKAQPTSILKKPKLERRRLFHEGQSRSLDY
DDLHTKSWGRRRIRYEDEVMPSSGDYPYPHSNPYSSYSPTAAMSRRYGSETNIRQSYMGA
NVDANHPLSHSHFLVTDDKIVTITYDSDVGWTRRGVAPSLFRGAHRQRGLADPRNHMSLD
LQRTSQQKLYGPAAPYLKRRRNLPHPPSAQNAHNFSPMEPGSGMDGLNAAAAGMVEQGNG
MGSGGAHNTTSTHNSNHHNSQASSVSVSQSHNQQLQQQQQLQQQSVRQKGKEGTTAISGS
MMASEQLTKSSSGSGGATSAAAAGHLVVGGTNANNASSSSFANPQPPPPQQQQQLHGSPN
NLNNNNKRAPSSTPQQNTNTINDANNLTLDATQQQSQQQQLQQPPNTCTNQNTNPTTTLT
TTTTTSSNATNAATTTTANATNATTTATNPTTTTTNNTNEPNATTTTTTTNANADADADA
DADAPLDAIDWDAIDAMLDDDFSEYDKDKNGAEEAGGSKSAEGAGAEDKVDGSLSDTAND
RKKGGGVDQERSPKGGSGMGKKSNSTSQLSATGRKRRMGFGKKGKNSFTVHRSEEVLPGD
ITRELRTGGGLGVSLGGAGGAAGGSGGAGGGGLSRGSSSEVDAIEQFFGDGAGGESLKLD
TWVQLRLFVVSEQEQYQAQFAIAGSSTSSAGHHHITLPPPHPYHQRQSRGSAGSIQRSVE
VPPVPPVTRYSAGSIHSITSSEGSSFSPSLRNDGALNEFVDGLGPGQLVGRQVLGAPSLG
DIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKTSSARRTL
DPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFG
TTSLVSCPTNIGLGSRRSSIASLDSLKL
Download sequence
Identical sequences FBpp0290770 FBpp0290770 FBpp0290770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]