SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290807 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290807
Domain Number 1 Region: 135-365
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.75e-82
Family Calponin-homology domain, CH-domain 0.00000235
Further Details:      
 
Domain Number 2 Region: 3195-3354
Classification Level Classification E-value
Superfamily Spectrin repeat 5.55e-27
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 4060-4219
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-27
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 4 Region: 4211-4332
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 379-496
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-25
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 5167-5242
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.96e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 7 Region: 3968-4109
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-22
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 8 Region: 2444-2593
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-22
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 2781-2914
Classification Level Classification E-value
Superfamily Spectrin repeat 9.83e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 10 Region: 4411-4549
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-21
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 11 Region: 3306-3451
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 12 Region: 3730-3877
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-20
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 13 Region: 4614-4735
Classification Level Classification E-value
Superfamily Spectrin repeat 2.26e-20
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 14 Region: 786-907
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 15 Region: 1947-2107
Classification Level Classification E-value
Superfamily Spectrin repeat 3.31e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 16 Region: 1505-1634
Classification Level Classification E-value
Superfamily Plakin repeat 8.37e-17
Family Plakin repeat 0.0029
Further Details:      
 
Domain Number 17 Region: 4327-4440
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-16
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 18 Region: 4765-4878
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 3620-3747
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 20 Region: 3423-3562
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-16
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 21 Region: 697-828
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000176
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 22 Region: 4832-4954,5026-5056
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000232
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 23 Region: 2162-2285
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000235
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 24 Region: 3888-4003
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000183
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 25 Region: 5076-5186
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000011
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 26 Region: 2974-3132
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000166
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 27 Region: 2708-2809
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000209
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 28 Region: 2350-2484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000023
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 29 Region: 1266-1367,1401-1425
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000326
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 30 Region: 1850-1957
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000158
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 31 Region: 1717-1838
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000173
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 32 Region: 2563-2685
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000158
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 33 Region: 1637-1748
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000464
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 34 Region: 1194-1296
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000835
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 35 Region: 635-729
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000301
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 36 Region: 1035-1184
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000345
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 37 Region: 467-594
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000504
Family Spectrin repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  FBpp0290807
Domain Number - Region: 913-967
Classification Level Classification E-value
Superfamily SH3-domain 0.000217
Family SH3-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290807   Gene: FBgn0013733   Transcript: FBtr0301592
Sequence length 5499
Comment type=protein; loc=2R:complement(9752859..9753000,9753954..9754137,9754207..9754480,9755661..9755854,9757365..9757482,9757548..9757777,9757843..9757960,9758027..9758201,9758345..9758416,9758799..9758843,9759171..9759230,9759484..9759658,9759714..9761673,9761739..9761964,9762364..9769841,9769906..9770052,9781635..9782097,9782344..9782474,9786955..9787176,9787871..9787954,9788942..9789077,9789192..9789822,9790159..9791077,9791319..9791687,9791753..9792666,9792727..9793006,9804359..9804529,9804623..9804712,9805354..9805415,9809052..9809481); ID=FBpp0290807; name=shot-PO; parent=FBgn0013733,FBtr0301592; dbxref=REFSEQ:NP_001163149,GB_protein:ACZ94421,FlyBase:FBpp0290807,FlyBase_Annotation_IDs:CG18076-PO,FlyMine:FBpp0290807,modMine:FBpp0290807; MD5=55a4df539cff725ebe060bd717aa7a0a; length=5499; release=r5.30; species=Dmel;
Sequence
MTSHSYYKDRLGFDPNEQQPGSNNSMKRSSSRQTTHHHQSYHHATTSSSQSPARISVSPG
GNNGTLEYQQVQREQRDRELYSNNGSLHHHQHHHHHHRHSTTGSASSPLYENSSSPAAPK
KAKHSSTQAQPQGGYEDALTQFKDERDAIQKKTFTKWVNKHLKKANRRVVDLFEDLRDGH
NLLSLLEVLSGEHLPREKGKMRFHMLQNAQMALDFLRYKKIKLVNIRAEDIVDGNPKLTL
GLIWTIILHFQISDIVVGKEDNVSAREALLRWARRSTARYPGVRVNDFTSSWRDGLAFSA
LVHRNRPDLLDWRKARNDRPRERLETAFHIVEKEYGVTRLLDPEDVDTNEPDEKSLITYI
SSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCREKTAYLQERSFPPTLIEMKR
LLSDLQRFRSDEVSARKREKSKLIQIYKELERYFETVGEVDVEAELRPDAIEKAWYRMNT
ALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLEGRIGEEGRRIERLHPVDAK
SIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHVSELHKKVNKLHQRWAQLRTNFHTNL
VQKLSGLKYPVHETTVTRQTRMVVESRQIDTNPHFRDLQEHIEWCQNKLKQLLAADYGSD
LPSVKEELDRQQHEHKIIDQFHTKILNDERQQTKFSGDELALYQQRLNQLQKVYAELLST
STKRLSDLDSLQHFLGQASAELQWLNEKEQVEITRDWADKQLDLPSVHRYYENLMSELEK
REMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLLQLTLCLEVHLKHATEYHQF
FGEIKDAEQWLAKRDEILNSKFSQSDFGLDQGETLLRGMQDLREELNAFGETVATLQRRA
QTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTLLDNSGRVKWRVRTAKGQEG
PIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRLRQNMIFATIRVVKGWDFDQ
FLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLRRLRREMDEVNRLFDEFEKRARAEEE
SKQASRIFTEECLAIKSKLEDMARELDQIILAPLPRDLDSLEHVLEIHSDYERRLHLLEP
ELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHKDRLKLLEASLAGLEDNEHV
ISELENELARHQDLPSTAEGLQQVFKQLNHMQDIITQQQPQMDKMNDAADQLGRMGVPTK
VLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCETAIGLMKNLQSSVQVEESWVDGTTER
LSAMPTATSAYELDKLLGAAIERKPKIENVNVAGGRLIREAKIYDSKCLRFVDWLVEARP
SFSPPRRDLRPADSDPGATQYYSQRLDNLNTKNDRLLEQLSQRLKTAIEVNGSDGLQYAE
SLQKPLKTFRVDFSAGSVPTGDGYAARQEDLYTTTYSTTQISSTKTTKSSTKSVYSSDGL
DAASQEVSTAGLPQSQIQFNEIRTLKRSQQLGGHSVLDIAGIRDPRTGRVLTIGEAIQLR
ILDVRTGEMLVGDRRITLEQAADQGLIDLQLAKQLLEPGAGRDASGRELSLLEVIQREIS
EAESGYETAEKRIKQAVFEKFNMCEENVNDLLKWVTTVEQKISSVGGPREKIDELRNQIN
ALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRSRVDRVNDRT
VRLLRRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQADSVREFVS
DVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPIRQEVSL
VSAQYKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSVHPRVSRIISEPIAGDPK
GVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPMEINQLELPIADLKNNY
QQLLDNLGEHCKTLDKTLVQSQGVQDALDSLVGWVNQAEDKFKMNLRPASLIKERLQEQI
REHKVLLADLQSHQASIDSVQVSAKHLLASASNARIAKKVESNLNDVTVKFEKLYEKANK
RGEFLDDVYNRLSRYLDEISTVEQRMASLQEALDSRETSLLSTEELARRMNELSRDKDQL
APQFEDCVRSGKDLISLRDVTDTGVLRDRIKALESQWRNINISIDERAKLSKQKAEQQLA
YEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKPICKDYRDYAPTIDKINDIG
AQYDALIRPESPARKRSTYSPIKRTSPLRRMSGDARSPSPTKGGILSPLSTGSSGFGSRR
SSQDGFQLSELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLNEELRKQYENLKGLAQFL
ERIQRQLPKESVSNKDEAERCIKQARKILEDMYEKQSLLDTTKAQVKDILRRKSDVPGAE
QLRQENDSIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDSKERMLTVLGPISSD
PRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGTPDAQAVEIKLKDILGKWD
DLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLDTLPTDGDHQENLRKIENL
ERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKKLDTKKAETE
ASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQHQIDTHEPIYREVMAREHE
VIMLINKGKDLTDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKKYSQTSE
TFLAWLRTAEDKLADLTPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGLGETFLSS
CDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLDDFNDELRNLDHSLGRCEDR
LAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGDADHLTS
EVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKLSPPGRE
IKIVQVQIDDVGKIQTKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTLRKTLGR
LDNRVRDHEDNLHSTLKALREFYDHQSQTLDDIQDVSDEFKRMKPVGSELDQIRRQQEDF
RNFRERKVEPLAINVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKERMNERD
RRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFLKKMLLD
RQNSMGSLANLGKEVANHCEPGERASIEKQLNDLMKRFDALTDGAEQRELDLEEAMEVAK
RFHDKISPLELWLDNTERSVKAMELIPTDEEKIQQRIREHDRLHDEILGKKPDFSDLADV
TAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDASDNIGALLAESRQGLRHLVLSYQDLVA
WMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELMKHISND
EAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSAEAALAP
SEPRQADVLRLEGELADMRPILDSINQVGPQLCQLSPGEGAATIESIVTRDNRRFDSIVE
QIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADLPAMEPKLVRAQLQEHRSI
NDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSERLGILE
QALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSIAEHKPL
LDKLNKTGEALGALVADDDGAKINEILDTDNARYAALRLELRERQQALESALQESSQFSD
KLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQRAANDV
IAKAGNKADPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQLNSVMKT
LKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMNMCGEPD
KPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAEDKFAHL
GAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIREPLSVV
NRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDSTLDQLKPIPGDPQLLE
VELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSVEASTTQEKLRKLNNEWKQLLQK
ASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLERFMEVY
NELDENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSRASDKKIKLE
IALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDVSTHREA
MLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKEAREFND
AWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYDGTMRTG
KNLLERAPKGDRPVLDKMLIELKEQWTRVWSKSIDRQRKLEEALLLSGQFSDALGELLDW
LKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLERSGNNPE
VGRQLDEMQSIWEEVKSAVAKRGERLQVALVDAEKLNARVQALFDWLDHAEHKLRYAKNA
PDDEKVSREMMDIHMDFMKDLRVREREKTETFEYAEDIINKAYPDAIPIIKNWLSIIQQR
WEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHEQLPDEIPPVEK
LIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVRGSSHDLREQSPDGTLR
RQSFKGSRDQGLNARKGSRITPTRDTPDRDRLPHYGPRFSPSTSGPELEFRSPRAKLLWT
KWRDVWMLSWERQRLLNDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMD
KDNNGMIPRDVFIDGILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQERK
PANDSDKIHDEVKRLVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGG
WVALDEFLQKNDPCRAKGRTNIELREQFILADGVSQSMAAFTPRRSTPNAAATASSSPHA
HNGGSSNLPPYMSGQGPIIKVRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGR
YTPRKVTYTSTRTGLTPGGSRAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTPSRIP
QRKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTITRKTASGSASPAPTRRNISGSS
TPSGMQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPFRL
Download sequence
Identical sequences E1JH63
FBpp0290807 NP_001163149.1.81976 FBpp0290807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]