The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Cellular Component |
IC (bits) |
H-Score |
| Molecular Function |
IC (bits) |
H-Score |
| Biological Process |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0290848 Gene: FBgn0086364 Transcript: FBtr0301634 |
| Sequence length |
403 |
| Comment |
type=protein; loc=3R:complement(9794908..9795052,9795119..9795261,9795330..9795508,9795631..9795926,9796000..9796161,9796230..9796351,9796674..9796824,9849368..9849381); ID=FBpp0290848; name=rdx-PC; parent=FBgn0086364,FBtr0301634; dbxref=GB_protein:AAN14346.1,FlyBase:FBpp0082335,FlyBase_Annotation_IDs:CG12537-PC,FlyBase_Annotation_IDs:CG9924-PC,FlyBase:FBpp0082337,FlyBase:FBpp0290848,REFSEQ:NP_650325,GB_protein:AAN14346,FlyMine:FBpp0290848,modMine:FBpp0290848; MD5=23b567ba58cd371a59f9b6c7dd063cd2; length=403; release=r5.30; species=Dmel; |
| Sequence |
MALARLPVNECQASQTARVTSNLHASSSTMAVSRVPSPPLPEVNTPVAENWCYTQVKVVK
FSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLYLLLV
SCNKSEVRAKFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLP
EDKLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLSVGGREF
QAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLRFIYTGKAPNLEKMAD
DLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLKAQTIDFINTHATD
VMETSGWQNMITTHSHLIAEAFRALATQQIPPIGPPRKRVKMS
|
| Download sequence |
 |
| Identical sequences |
A0A0R3NH15 A0A1W4V5V8
FBpp0100174 FBpp0290848 NP_650325.1.81976 XP_015037339.1.19638 XP_016034763.1.80810 XP_016960064.1.21709 XP_017001259.1.47939 XP_017046929.1.74164 XP_017084415.1.81094 XP_017091707.1.53830 FBpp0100174 FBpp0290848 |
