SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291098 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291098
Domain Number 1 Region: 678-759,952-959
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000216
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291098   Gene: FBgn0003475   Transcript: FBtr0301884
Sequence length 990
Comment type=protein; loc=2L:join(20311820..20312414,20322010..20322080,20334081..20334198,20334621..20334730,20336287..20336404,20336467..20336549,20339245..20339375,20339582..20339693,20339980..20340112,20343599..20343672,20343743..20343947,20345525..20345670,20345906..20346244,20346308..20346511,20346578..20346891,20346950..20347169); ID=FBpp0291098; name=spir-PE; parent=FBgn0003475,FBtr0301884; dbxref=FlyBase:FBpp0291098,REFSEQ:NP_001163020,GB_protein:ACZ94306,FlyBase_Annotation_IDs:CG10076-PE,FlyMine:FBpp0291098,modMine:FBpp0291098; MD5=1ada03ada5e05f0253223ae2e3fda17f; length=990; release=r5.30; species=Dmel;
Sequence
MTEHQAEEQADTPPTKVKATPTPTPSGKFKDAKEDAFLSTSPDSANGDAQHKLPADQLAM
SSSAHPQQAGQARPLILQAFHRCSSPEQCVTLHDILDSFKAPLSEDQAWALIHQFAGLYH
QVAVQAHTCAADYEAALPTGFELHFHRDGSVHFSGPDQLTPKEQLQQEQIPLPPQHDVIV
DQPDHSASSSGDSSVINRAFDNSNHHHHHQHHHPPLVVSHRKIISELAEIVYTALDYNLP
EDEECQVSQELENLFNFMTADETDDDCIDEGIDEGDKRWDDESEEERNDTKELEHIIETC
RNHIKTTLPENHYRAVCRALVTETIELRVFLQQVLNNAGAEKLIKASESSATTQQELAKL
GFNDWARFWVQVIDELRRGVRLKKSNHERTPIEYELTPYEILMGDIRAKKYQLRKVMVNG
DIPPRVKKDAHAMILEFIRSRPPLKKASDRQLGPPRMCEPSPREQLMESIRKGKELKQIT
PPEAPTLRERVLPSANSTLSRSRQRLIKVDFSKFQDDDLFYDENSISSSHSTAATHQHHP
HFAEMHRCSQPKMPPYPFGGYMVPSQARQDCRETASLMRPRRTTYDLATQCESRRASLRR
HTIVGCQSNLDETHSMPPTRPESRQSDDVSKETPKRSPAEQTHPSDEGSSTSSLGPWNKS
FMDKQTWMERGDDRLSVTLAEIVHIRSVMTKAELEGLPMDVRVKEDVEKRRVCFLCLRTR
FSFFGPWGIQCKLCQRTVCAKCYTKMRIPSEHFRNVPLVLISPSLLSSPASSSTPSPSHH
AQQAHSSSTGNIMDDQFPKSLIERLLRSESDRKTRSTVGSAPSSPKHQRSNMSTPGISVG
PGASSSSAAATGQAVEALHDQATMSSSYSAAMRPSGVHQQQKQHYNNAMSRSMEGPRSLP
VHSPAYRPLSNNSTLERKSRFSRGFNLFSSGSHLAQTQEQKENLRGEQVTVCNDCQGLVN
EITSSVKQKRSSARNRTIQNLTLDLTPVWK
Download sequence
Identical sequences E1JHM3
FBpp0291098 NP_001163020.1.81976 FBpp0291098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]