SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291363 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291363
Domain Number 1 Region: 2515-2777
Classification Level Classification E-value
Superfamily YWTD domain 4.31e-46
Family YWTD domain 0.0000167
Further Details:      
 
Domain Number 2 Region: 1561-1820
Classification Level Classification E-value
Superfamily YWTD domain 7.71e-45
Family YWTD domain 0.00000517
Further Details:      
 
Domain Number 3 Region: 3337-3601
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-42
Family YWTD domain 0.00000463
Further Details:      
 
Domain Number 4 Region: 838-1070
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-40
Family YWTD domain 0.0000242
Further Details:      
 
Domain Number 5 Region: 4211-4483
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-37
Family YWTD domain 0.0000202
Further Details:      
 
Domain Number 6 Region: 500-735
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-35
Family YWTD domain 0.0000392
Further Details:      
 
Domain Number 7 Region: 2195-2455
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-34
Family YWTD domain 0.0000417
Further Details:      
 
Domain Number 8 Region: 1867-2143
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-29
Family YWTD domain 0.00051
Further Details:      
 
Domain Number 9 Region: 1477-1555,1848-1861,2139-2187
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-19
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 389-489,758-808
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 11 Region: 2859-2902
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000209
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 12 Region: 1182-1223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 13 Region: 2984-3026
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 326-367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 3910-3947
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000523
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 16 Region: 3699-3739
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 17 Region: 3951-3988
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000111
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 2824-2862
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 19 Region: 1223-1261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 20 Region: 3784-3822
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 21 Region: 1267-1304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3994-4031
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000693
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 23 Region: 4126-4183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000718
Family EGF-type module 0.011
Further Details:      
 
Domain Number 24 Region: 155-190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000811
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 3125-3160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000824
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 3033-3069
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000115
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 27 Region: 3165-3204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 28 Region: 3742-3780
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 29 Region: 1147-1182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000222
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 1303-1344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 31 Region: 1355-1387
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 32 Region: 2900-2941
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 287-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000366
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 34 Region: 3210-3225,3258-3329,3595-3670
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000408
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 35 Region: 4082-4118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000602
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 36 Region: 3868-3906
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000811
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 37 Region: 4037-4073
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000864
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 38 Region: 1390-1424
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 39 Region: 2948-2986
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 40 Region: 3661-3696
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 41 Region: 1434-1469
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000576
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 42 Region: 3820-3864
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000589
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 43 Region: 191-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000576
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 44 Region: 3080-3118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 45 Region: 4541-4573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000632
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0291363
Domain Number - Region: 263-288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000122
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number - Region: 2782-2841
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00259
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 4487-4512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.009
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1823-1859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 2459-2518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0274
Family EGF-type module 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291363   Gene: FBgn0261260   Transcript: FBtr0302153
Sequence length 4769
Comment type=protein; loc=X:complement(9254347..9254567,9254639..9254886,9254966..9257152,9257214..9257526,9257590..9259094,9259159..9259565,9259625..9259836,9259911..9265571,9265652..9267970,9269037..9269291,9269390..9269662,9276643..9276774,9277240..9277398,9366032..9366449); ID=FBpp0291363; name=Megalin-PA; parent=FBgn0261260,FBtr0302153; dbxref=REFSEQ:NP_001096924,GB_protein:ABW09371,FlyBase:FBpp0291363,FlyBase_Annotation_IDs:CG42611-PA,FlyMine:FBpp0291363,modMine:FBpp0291363; MD5=e18abd541e3f5a5bb3c314006bc6c791; length=4769; release=r5.30; species=Dmel;
Sequence
MNPTPVGIGFGFGRKPPSKARMRSRWRPPSATTLLTHDPANGDSHTAADPLQVTDAAPSG
PPSSSSSSPIGDRHSQHHSSSAIDRRLQQQQHHQSPQHHRQRGQLTTLALLLLALVAISN
LETLLAVRTEGPRNRHGSPGGSLASTGGSSSGINTECPTDSFRCNNGKCISHHWVCNYQK
DCDDGEDEMQSCPPPECETPQLNCGQYTFNKTYCIPPHYRCDMIEDCEDKSDEAQCTYRK
CQHTDLFCNTPTGAPAEGARLTGPCVPKEKRCDGYLDCRTGRDEVGCSGVACRLDQFRCA
NGLKCIDAALKCNHRDDCGDNSDEQGCNFPPCHHAQFRCTNALCIPYNFHCDGYHDCADK
SDEANCTAIACPDNKHLCPRGGASGTPKCILKSQLCDGKRDCEDGSDEETNCSIASCPAL
SCEFKCGPSLTGGVCYCKPGQSLAPDNRTCVDLDECAEWGHCDQLCTNTLGSYTCQCAQG
YTLINDSKCIAPDANNLQLIFAHDRAIMRMLPHGSEPKILANATAAAGVTFHYARNTLYW
SDIKTRKVQSLPLDAQNKAVSPFDQTLPGTWAPVALAVDWVGDKIYVADLVGQKIDVFEL
SGQWHAVVLGSNLTSPADLALDPTAGLMFVADGGQVLRAHMDGTHARSIVSEAAYKASGV
TVDIISKRVFWCDSLLDYIESVDYEGAHRVMVLRGQQVPSPSRLALFENRIYWTDATKQG
IMSVDKFEGPTSIQVTYKAKDIREPKGIIAVHALSQPRVSNPCGNNNGGCNHMCIVTAVK
GAPTGLGFRCACSTGYQLETDLKLCKPVSEFLMYSQQRFIKGKVLEPVIEGFSDAIMPVV
SRRARFVGLDFDARDEFIYYSDVLQDVIYRVHRNGTGREIVLASQNEGVEGLAVDWASKN
LYYIDSRKGTLNVLSTRNVTHRRTLLKNLKRPRAIVVHPNRGFIFFSEWDRPANITRANT
DGSGLLVFKNVTLGWPNGLSIDFKEDRVYWCDALLDHVQHANLDGTDIKTVNSRLVRHPF
SIVIHNDWMYITDWRLDAIIRLHKLTGEQEEMMVREPQTNRLYGVKVYSHEVQRIADTQP
CHRNNGGCQKICFAVPIGASNGTDGVTTSSPSFGRLQSRCSCPYGERLADDQVSCIPDPS
AEPPVQPCPNSWDFTCNNQRCIPKSWLCDGDDDCLDNSDEEQNCTKPTCGSNEFQCRSGR
CIPQNFRCDQENDCGDNSDEQECGNVTCGTSQFACANGRCIPNMWKCDSENDCGDSSDEG
DFCAEKTCAYFQFTCPRTGHCIPQSWVCDGDDDCFDKQDEKDCPPISCLANQFKCADLRQ
CVEESYKCDGIPDCNDGSDEVGCPSMGPNQCNLEKHFRCKSTGFCIPIAWHCDGSNDCSD
HSDEQDCGQITCAQNFFKCNNTNCVFKAYICDGKDDCGDNSDEGAEHACVPPPFKCPHGQ
WQCPGVSERCVNITSVCDDTPDCPNGSDEGEGCDLAECEHQAGQCSSFCQKTPNGALCVC
PPGSEIGEDGYTCIDSNECDPPGLCSQQCTNTKGSYFCSCTDGYVLEPNKHTCKAVNHTA
AFLIISNRHSILVADLKEQGLERVPIIVENVVATASNMHTGTIFWSDMKLKKISRLDRGM
EPQEIINTGLDLVEGLAYDWIAQNLYWLDSKLNTIEVSAENGSNRLVLVRENITQPRGMC
IDPSPGARWIFWTDWGENPRVERIGMDGTMRKTIINTKIYWPNGLTLDIATKRVYFADSK
LDFIDFCYYNGTGRQQVLASSHYLLHPHSLSLFEDTLYWTDRQLNRVLSANKFRGKNQTV
VSHLISQPLSIHVHHASLQPMTPNPCAGSRCQHLCLLSPSAPEGYSCKCRPGFKLLSEGR
CIEEENPFLMVVKGTQIVDLPLNGGDARAGALAPVIGIESSTGLDFDRKGETLYWVQGRE
DDDENCTIYTTPYGGGNKTLFLGIENGIVGAPYTIAFDWLGRNLYIGNRVASNIEAVRVD
GKQKYRTIILANDGYPNSVSRPKQIALDPTEGKLFWIDEGVLEVPIKIGRVDMNGQNPIV
VFQEFAHPESLAVDTEKKMVYYSASNPAVIGVMDYNGDDHTLILMKDSHPMAKPRSLGIL
DHRLYYLDPLYERIVRIDLPHGDNPKTIVDNESDLRSMMIYKKRALMQHPCQTNNGGCKH
LCIPGPGATRTCACGIGYRKENEINCVAYKIFAVVSQLDMIRGYSLSDSSEAMVPISGPG
HHILHVDVMYREQWIYWAEYNRGYWNGIFRSRPNGTDLQHVVKDGIGSNGIRGLTIDWVA
GNMYFTNVYPHENYVEVCWLDGSNRKVLVKTTTDAPRELAVNPIKRLLYWIDYGQHPRIG
KALLDGSKWTPLVTSGISLPRDLTIDMQTHDIYWVDSKLDTIQKISYNGANRKIIRRDLP
NPMGIAVYLNDVYWVDRNLMTVFKASKHSANETATSVRTNLEKLRDIAIYNINNQPQDDT
NPCAHLGNGGCDQLCFSFPPDGGASGTSGGRNFRCECATGKLSADERKCEVVNEYLVFAT
RTEIRAVNLDPHSTEVPFTPLTNLTNVVGLDFDFAHNRMLYTQIRPWAKIAYTKANKPGH
DDITVVLNKGINPEGIAYDWTQQKIYWTDSSNNSIYAMNLDGSELVMIARVERPRAIVLD
PCNGTLFFTDWGRFGTSGKIFRTTMAGSLKRAIVDKDLSQPSGLAIDYDERRLYWTDAVR
EKIERSDLDGQNRELLVAATIYPFAITVFRNYIYWTDLQLRGVYRAEKHTGANMVEMVKR
LEDSPRDIRIYSSDRQKCNVNPCRINNGGCAQSCHPAPNGKAECKCDDSTKVVNEGRMCA
PRNNTCEASKFYCKNGRCISRMWSCDGDDDCGDNSDEDPNYCAYHSCSPNEFRCNNGRCI
FKSWKCDHENDCKDGSDELGCVYPPCVDGEFTCANGRCIPQAQVCNGVNDCKDNATSDET
HERCPMNTTCPANHLKCEKTNICVEPYWLCDGDNDCGDNSDEDPLHCGQRTCPTNSFRCP
NHRCIPATWYCDGDDDCGDGADEPPDYCKSEGRTCFGDLFTCDNGNCIPRIYICDGDNDC
LDNSDEDNRHQCNDRKCDEETEFTCVENKSWQRAQCIPKKWICDGDPDCVDGADENTTLH
NCATQQPCGEDMFTCGNGRCINKGWICDHDNDCGDGTDEGKFCNSKYKTCSAQEFTCQNF
KCIRNQSRCDGEDDCGDHSDEVGCAKENITCPQGQFACTNGQCIDYNLVCNKYPDCADES
DEPAHCNVDECAKVEINQCGHKCVDTLTGYYCDCNEGYKLLADGKACADVDECLEQPGAC
SQHCSNTPGGFYCKCDETYYERQNDEHTCKRKDKIPPWLIFTNKYYVRNMSVDGHQYNLM
HQDLMNVVALDFDIREEYMYFCDVTAKTIFRAKYGEADDEMPPEREAVIRHDSHGLEGIA
IDWVGRKLYWLDRHSKNLDVSELDGSKRKTLRSGVVDPRAIVVHPGIGYLYFTSWHLQAY
IAKMGMDGSNFSRILNWNDGIAWPNALSIDYFTDRIYWADAHLDYIAYADLEGRHRHTVL
SGSKVPHVFALSLFDDYIYWSDWNLKAIVRANKFHGANYTVLRNTTHRPYDLHINHPLRQ
LPYTNPCGTNNGGCSHLCLIAPPPESTYLNIEGYIEEGAPIFKCACPNQFYLARDMKTCV
ANCTAGQHLCGGRDEKCIPWFWKCDGEKDCKDGSDEPATCAPRHCRAGTFQCKNTNCTPS
ATICDGVDDCGDRSDEQNCDLPCPLSDFKCKSSGRCILDSWRCDGDADCKDGSDEDPAVC
FKRTCDPKTEFSCKNGRCIPQLWMCDFDNDCGDDSDEPAYMCRQRNCTTGWQRCPGQSNY
RCIPKWLFCDGKDDCRDNSDELPENCPKCNPETDFKCGNNRCIPKQWMCDFADDCGDASD
ENEAVCKGRYRECSESEFRCGNGKCISSRWQCDHEDDCGDNSDEMHCEGYQCKNGTFQCA
SGHCIASYFRCDGDRDCRDMSDEVGCPPRFPGGRYCPESRFQCNNNLCVSLSDLCDGTDD
CGDGSDEDPSVCSDFNCDTLRRFQCSNERCVARYQICDGVDNCGDGSDENNMTLCASKQK
PCDLYTQYQCANKHCIERSQVCDFSDDCGDASDELGCHHTSSCSEANRGGCQQHCHNLTD
GGYICTCYPGYIIAADNKKKCSDVDECLTRQHTCSHQCHNLNGTYSCSCREGFHLTDGAS
GVCRAEKEDVILLFVNGQEIRGLNWHKSEEFAVIAAEKRIEALDYDAQQQIVFWADSYDK
TIKRSYMVNAIDGRAKIGFAQDLNMKGGSKPTAVAVDWLASNLYWTEMDRTGSKPRGRVM
VAKTDGRYRRSIVNAGLEVPTSIAVNPQLGRIYWSDAGSAPKIEVSWMDGSKRRPLITEM
IRHPAGLTIDYSQDHIIYWVDTKLNAIESMRADGSRRKAIVRGDQLRHPVSLDLFESNMF
WMTRDTGELVRQDKFGRGVQVVLHRYIVNPSGLKVYHDKRYNTSLPNPCDNSTCSHLCLL
VPGGHRCACPDASGPPPSHRSTAEVICNAAAEHPRPAPRICPCQNGGLCKEDAQGELLCE
CRTQFVGEHCETSTMGAFGHGDANVTAVVVPIMVILLVMMAAAGAWYVIRKRPFGKLARM
PAMTSSQSVTFRHGSNVEFNESGFPGASAPGAGDVAPIEGYNLQTVNANKARDFANPMYD
AVQSGTTADPGMGNGSGIYDVPGEPSAKVKSMGHHAGGSFTEPASAIIAPSSITHKASPQ
LQLRTRELDPSADTGKDTQFLVEEDKSEC
Download sequence
Identical sequences A8JTM7
FBpp0291363 FBpp0291363 NP_001096924.2.81976 NP_001285053.1.81976 NP_001285054.1.81976 NP_572563.3.81976 FBpp0291364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]