SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291434 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291434
Domain Number 1 Region: 225-350
Classification Level Classification E-value
Superfamily HCP-like 0.000000000212
Family HCP-like 0.015
Further Details:      
 
Weak hits

Sequence:  FBpp0291434
Domain Number - Region: 77-205
Classification Level Classification E-value
Superfamily TPR-like 0.000295
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291434   Gene: FBgn0051687   Transcript: FBtr0302224
Sequence length 351
Comment type=protein; loc=2L:join(20450301..20451276,20451335..20451414); ID=FBpp0291434; name=CG31687-PB; parent=FBgn0051687,FBtr0302224; dbxref=REFSEQ:NP_001163022,GB_protein:ACZ94308,FlyBase_Annotation_IDs:CG31687-PB,FlyBase:FBpp0291434,FlyMine:FBpp0291434,modMine:FBpp0291434; MD5=84fd8692066c161ad35ba77a289ad9ca; length=351; release=r5.30; species=Dmel;
Sequence
MAMQKFFSVLLPDVKRELRRGIIECSKRGLLHSTKWLAEMHHGLADVHIDNEAPDEDRTF
SECQLEGIAPEEYSDYFLAKSYYDVREYDRAAHAVRNCESSVPRFLHFYSSYMAREKRRL
DSTTDQANLHEPNQMRDLADLLATLRMEYGKSRLDGYGIYLYGVVLKALNLNQAAEQMLV
QAIRLVPMLWSAYLELSPLIMEKKKLLSLQLGGHWMRHFFMAHTYLELYLNDDGLKIYED
LQASGFSKSIYLIAQMALVYHNKRDVDKAIELYQALLESASPYRLDNVDTYSNLLFVKEM
KTEMAQLAHKAVSINKYRPETCCVIGNYYSIRCDHQVAISYFQRALKLNPK
Download sequence
Identical sequences E1JHM5
NP_001163022.1.81976 NP_001260627.1.81976 FBpp0291434 FBpp0291434 FBpp0305184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]