SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291460 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291460
Domain Number 1 Region: 6-204
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-50
Family Motor proteins 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291460   Gene: FBgn0058155   Transcript: FBtr0302251
Sequence length 214
Comment type=protein; loc=3RHet:complement(1042..1561,92066..92187); ID=FBpp0291460; name=CG40155-PB; parent=FBgn0058155,FBtr0302251; dbxref=REFSEQ:NP_001015230,GB_protein:EAA46212,FlyBase:FBpp0291460,FlyBase_Annotation_IDs:CG40155-PB,FlyMine:FBpp0291460,modMine:FBpp0291460; MD5=d2082ebc27d8cc1bc0297a089c964851; length=214; release=r5.30; species=Dmel;
Sequence
DIQFINSSYPRGSSKSKCTVSDNFRNQLQSLIDVLQNTKPWYVRCIKPNLQKRPNNYNSS
LVLDQLKYLGVVDIIRIRREGFPIHLSHKDFIVRYKCLIKNKSFEYPQKYLTNILEKNGM
PTTEWQIGKSKIFLRNAAYELLETNRKDTLYKNAVIIQKNWKKYYIQKSFLRNKQAVLRI
QHAYRGWRLRIRFMRMRRSAIVIQSRLRGVFARE
Download sequence
Identical sequences FBpp0291460 FBpp0291460 FBpp0291460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]