SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0291786 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0291786
Domain Number 1 Region: 464-642
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.51e-28
Family Laminin G-like module 0.0081
Further Details:      
 
Domain Number 2 Region: 1084-1268
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.17e-23
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 3 Region: 243-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-18
Family Laminin G-like module 0.0083
Further Details:      
 
Domain Number 4 Region: 1551-1731
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.57e-17
Family Laminin G-like module 0.045
Further Details:      
 
Domain Number 5 Region: 1283-1436,1468-1526
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-16
Family Laminin G-like module 0.027
Further Details:      
 
Domain Number 6 Region: 680-829
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000187
Family Laminin G-like module 0.039
Further Details:      
 
Domain Number 7 Region: 117-173
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000199
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0032
Further Details:      
 
Weak hits

Sequence:  FBpp0291786
Domain Number - Region: 438-478,840-880
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000392
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 873-939
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000493
Family Fibrinogen C-terminal domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0291786   Gene: FBgn0261546   Transcript: FBtr0302646
Sequence length 2148
Comment type=protein; loc=3L:complement(4637434..4637757,4642677..4642807,4642938..4643244,4643397..4643726,4644044..4644225,4645560..4646180,4646824..4647024,4650321..4650776,4650937..4651184,4655973..4656372,4656560..4656774,4659480..4660012,4660077..4660409,4664127..4664323,4664423..4664953,4670118..4670402,4671826..4671961,4673173..4673392,4674956..4675229,4675382..4675904); ID=FBpp0291786; name=axo-PB; parent=FBgn0261546,FBtr0302646; dbxref=FlyBase_Annotation_IDs:CG42664-PB,FlyBase:FBpp0291786; MD5=7f055e2e979f243e670e8434e42b1a55; length=2148; release=r5.30; species=Dmel;
Sequence
MAFPYIWALLPLICSASGLSLPNMTSTDAVVAGGGILPILVAGNPGNLGSSNMSLSGGGG
LAGSSTGGQSLPDTGGGNSAGGSPAGGSSGTGGGGSNSGISGNNSAMIQGQKSNQYEKCA
GPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHCIGGPHTLPPF
LQSTTREPSTTESSMLLGLPYTQSPAQSPDGMGGAEGGDGTTPVPIEQRGPELTFAETGQ
GKTFIFAKNNTFIQMDGDIIQTFQLRLCREISFQFRTRLPHGLLVYHNVKNPDRINLDPY
ALYVIVEKGQLKVVHVFGKHSTSVTVGESLNRDEWHSVMVRIDVHGARLIARVDNSQEEV
YLKGLNHEYNYGVSTNLPSVVLVGGLSSEEKLHGVKYITESFVGCIRNVVLSSGKAASDL
LPIAPLVATKHENVNEGCSDMCESRHNLCFVGSRCINHYGGISCDCFGTHYEGEHCDIYT
ATIITLRGASYVSYRIYDWKDRVHSSTRRISLMFRTNFDDSALFYASGESLKHQYIAASI
KNQSVHVEMDFGDNVMSTVLTDDLTRGYWHNLTILHEQRTVSIILDQQQKVLELPATASG
NMLFDPEIYFGGGPELHKKKGLASHNNFVGSLKYVYYNDISILYELQRGNPKVHYHGVLE
AEFVENEVNVIPITYPFATSHIWWPINHAEEFNIKFDFRSSRPGAVLAYSDVTTSAGNGF
WEIRLTSDKLSFDLVPDVNNNVTHSTTIKINRATSWHSVELDYKLGEIRFTVDYRHTLSQ
MYGLTFNIGDKLIIGSSLKSAAMGLVGCIRDIEINGHLIEPRHVVKTERVVGEVALDNCN
YIDPCKRPNTCEHGGKCFVKDDRVTCDCKHTGYIGKNCHFTKYRKTCEELALLGFTKSDV
YLIDIDGNGVFPPAHVKCDFQSLENATKTIVEHNLPSQVDVRSARESDFSFNIRYREFSP
HMLQELISHSLYCTQYIKYDCYRAQLELHSATWFTSSAKNLTVDFLGNVKRGACPCSVNK
TCVDPNQSCNCDVKENKWNSDEGYYQDPQSLGITNMYFLQQKDMDDEAQGRITLGPLECV
ETNTQKYVVTFTTSQSYIEVPGWRKGDIAFSFRTTGEKAILLFQPPIRPHYPSFMVALTG
DDQLTFTFTLSTGTTRELVINSHRRLNGGEWHKIWIDYNQYHVRFMINTDYQMLDLLPEE
EFGPFEGSMYIGGATFDLLKKLSVKAGLIGCFRGLVVNGEILDIYSYMSVHLSEIIKDCK
PSCVPSPCRNGAQCKELWSSFKCVCNNPWAHIGEFCETNINEKALTFINRESFLMRNYLS
VGATPVILMHGINGERDVLKGILNQDLLINLRTYDTNALVLYANDHYNNFVHLYISLNRE
IVFLYNYGDEIVNLTLLDDTLMASLKSIQVAIVRGEQETRMHVNEHSVSIDRGTLLLDEY
ANKPWSNPEKEVLSPHRPPAPPTEYFQFHVGGYDPANLLRPNVDAPALEGYIGCVRGLKI
GAQLIDLADINERNIAPTQEGVLPNCQIKCDAEPCKNGGTCQEHFAEQLSTCDCEHTSFL
GEFCSEEKGADFSGESTLQRKFELPGTGRVDYVRLQLAFSSFDLRRANRIMLLMQTEAER
SYYLLLAITSDGYLQLEEDRDNGQTVGARIDRNFLNSARHSVYYVRNGTQSQLFIDREQV
PLSEFAARVLTTGGDAGSNRVQIGGINSTDSRFAVFKSYSGCLSNIYIQVNGHVMKPLEE
YMLFTKSGADNITVINPQGVRSAQCNAKFDVSEQPTQEPMVNVSMIPEPWVEEPPARVPY
IPRFVYDENKQEDSTQVVFLTLTSVFVIIVICCLLEVYRSHLAYKKRIERETDEDIIWSK
EQATKMHESPGVKAGLLGGVTAGSGNGLPPYTYKALPQEDKKPGNGAPLVGILKNGSATP
SQPGTPTALSKNGDIASRIEEEEEEEDEAPAQKAAEKSGENEEPPAKDTTASEIKESQAQ
PPEQLAKDTTDASAAPKASKETEAQAEPSEPSSQLNSAQNGQLAQMEQAARGDEVQVPSL
PQQHEMQKQLPPQRQLSQRGVGIQQQTSSKRRKPVGSGGAGGATVVGPATVRRQVSWGPP
IVAETDVDLANNSSGNGNGNGNGNGNRKAGGKQNGYHGVNRRATTTRN
Download sequence
Identical sequences M9NFN0
NP_001246630.1.81976 FBpp0291786 FBpp0291786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]