SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292061 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292061
Domain Number 1 Region: 305-420
Classification Level Classification E-value
Superfamily TPR-like 4.34e-18
Family Tetratricopeptide repeat (TPR) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292061   Gene: FBgn0037855   Transcript: FBtr0302935
Sequence length 868
Comment type=protein; loc=3R:complement(6715637..6716567,6716816..6717113,6717236..6717702,6717807..6718025,6718085..6718296,6718362..6718573,6718637..6718904); ID=FBpp0292061; name=CG6621-PB; parent=FBgn0037855,FBtr0302935; dbxref=FlyBase:FBpp0292061,FlyBase_Annotation_IDs:CG6621-PB; MD5=6fa05152cad3ea9c79991993a3fffffb; length=868; release=r5.30; species=Dmel;
Sequence
MNFDYIGQALGYHGQPLQKIWDDERGVDDLRLMGLTQVNYGVYQERQKYFTFQERAKRLK
MHQFLARKATDLYDRTLVANVMEDSLLAQGNTYMTQMAPFEFFLNVKDKRKGWAHRLSAL
KQGDIIYTQVTRLASGNRLIVKPLCTAEPKHAYLADIPIKAVILQDFWGPLPLDKQGNPR
SFVQNDILRCEINNISADTERLSLNMIGMFNKVPDLKFGLCDFKELPKYYSKIHNLDHPS
ASHYEDELNKALEFENPNYDLLFQMNGLQPNENLSLMSYLRAGFPEEENAAELRQKQASQ
WAFRSVADGIEHFKNGQQVEAFQCLNKALNIDPRNVEALVARGALYANRGSFLKGLQDFE
KALHLNKYHVNARKYMGETLVALGRSYEEENRIAEAVKAYSDCLNLLPLHEEARQSLDAL
HRSGDGKRRISTEPSNMTGGQSSDESSSSSASDSECEDSAGKPKSNISQPFYAQHKLKQS
GDEKLAVIDAHKANEFRLDDDETVSSVRKLLREASKHKKAKKKGKKKKDKKERRRSRTKS
ETEDPIELLKKIDFQEALRLMNSTRSDEERKAKIKSYLKEGGKESPPPPPPMKKTAVSSR
KSSFDNVGPSTSRHAASVVGFGGAQPPPAPKFLGQKKHPEPAPKLSFQIKKRPLQMDKLG
MLRLAAPAEPLKGGRSSSSRSRSRSRSRSRSRSRNRRLGRSTRSSLRSRRSGSRSRSISR
SRSRRRRTYSRSRSPSPRSYGNRFVIGRYRNRRTRRSRSFHRRRSPSPILKRRSPSPFVP
RRTPSPASRYRRSRSRSRSRSRSRSPRRFQSRYMPRDRGSVNRSRYSWHNPHKRSVSRTV
EPNGKDERAATPPKKGVADDRSGREERA
Download sequence
Identical sequences A0A0B4JDC3
FBpp0292061 NP_001189210.1.81976 FBpp0292061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]