SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292348 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292348
Domain Number 1 Region: 371-394
Classification Level Classification E-value
Superfamily DPY module 0.0000288
Family DPY module 0.0022
Further Details:      
 
Weak hits

Sequence:  FBpp0292348
Domain Number - Region: 103-126
Classification Level Classification E-value
Superfamily DPY module 0.00981
Family DPY module 0.0046
Further Details:      
 
Domain Number - Region: 326-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 64-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0285
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292348   Gene: FBgn0031089   Transcript: FBtr0303256
Sequence length 440
Comment type=protein; loc=X:join(20042292..20042294,20044098..20044269,20044631..20044869,20044978..20045059,20048231..20048847,20049132..20049341); ID=FBpp0292348; name=CG9572-PB; parent=FBgn0031089,FBtr0303256; dbxref=FlyBase:FBpp0292348,FlyBase_Annotation_IDs:CG9572-PB; MD5=af6404185cc6c0e7352cb7d34407dd69; length=440; release=r5.30; species=Dmel;
Sequence
MQLLVVALVAVAIASLPQLAAGKKLGKRCVNCTYRTYYTYGDGRSLQRVVYRDPVYTRAQ
SYASGCSGSPCGVNAVCQEASGGRPVCSCPPGFSGNPLTHCNRGECLDNVDCRDNLQCKD
NRCVNPCVGACGIGSNCDARNHVAVCSCPAGYNGDPYHACHLNDPEEQCHPSPCGVNTKC
EIINGVPTCSCVHGYVGNPLSGCRHECDHDGDCSSRDMCSSNFKCVPACGQCGTGATCRT
VSNHRAVCECPKGYIGSPYTECRPECYGDADCPAGRPACFYGICKNTCEGACGIGADCNL
RGLTPVCSCPRDMTGDPFVRCRPFTKEDLCDPNPCGTNAICVPGHDNTGRERPVCNCLPG
HTGNPLSHCTRGECLSNNECPDHRACINYQCIDPCIGKCATGASCEPKAHLAVCRCPQGQ
SGDALVSCRQTRTFPVAKYH
Download sequence
Identical sequences E8NH67
FBpp0292348 FBpp0292348 NP_001188676.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]