SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292385 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292385
Domain Number 1 Region: 3362-3535,3575-3755
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.1e-45
Family Protein kinases, catalytic subunit 0.091
Further Details:      
 
Domain Number 2 Region: 718-886,923-928,1042-1246,1303-1512
Classification Level Classification E-value
Superfamily ARM repeat 1.58e-26
Family Armadillo repeat 0.041
Further Details:      
 
Domain Number 3 Region: 16-155,261-431,615-858
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000184
Family HEAT repeat 0.064
Further Details:      
 
Weak hits

Sequence:  FBpp0292385
Domain Number - Region: 2691-2719,3017-3054
Classification Level Classification E-value
Superfamily TPR-like 0.000331
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number - Region: 1800-1964,2009-2381
Classification Level Classification E-value
Superfamily ARM repeat 0.000374
Family MIF4G domain-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292385   Gene: FBgn0053554   Transcript: FBtr0303293
Sequence length 3790
Comment type=protein; loc=2R:complement(1065555..1066127,1068055..1069272,1071012..1071131,1071629..1072165,1073080..1075861,1081062..1081212,1082417..1082699,1082756..1084342,1085316..1085611,1085973..1087365,1088951..1089568,1091257..1091460,1091510..1091644,1091699..1091783,1098007..1098379,1099834..1099972,1104850..1104940,1129401..1129567,1129890..1130087,1133457..1133642,1138234..1138470); ID=FBpp0292385; name=Nipped-A-PE; parent=FBgn0053554,FBtr0303293; dbxref=FlyBase:FBpp0292385,FlyBase_Annotation_IDs:CG33554-PE; MD5=9c96fff90097191a9eb0140feab0fa39; length=3790; release=r5.30; species=Dmel;
Sequence
MSVIENVPVNTFRNYLNILNDSSSKDELKLKATQELSEHFEMIMQSPAYPSFLDNSLKIF
MRILQDGEPQFIQENTMQHIRKLILEMIHRLPITESLRQHVKTIITMMLKILKTDNEENV
LVCLRIIIELHKHFRPSFNSEIQLFLGFVKEIYTNLPNHLTSIFETSNDVWVTDLKDLNL
EVLLSESYSVRTIHVEKALDSNSQQQIYNLLPRGILSLKVLQELPIIVVLMYQIYKNAVH
QEVSEFIPLILTTINLQPTVTRRNSPQKEIYVEFMGAQIKTLSFLAYIVRIFQEVVIASS
LSVTSGMLNLMKNCPKEAAHLRKELLIAARHIFATDLRQKFIPSIEQLFDEDLLIGKGVT
LDSIRPLAYSTLADLAHHVRQSLNIDVLIKAVNLFSKNVHDESLAVGIQTMSCKLLLNLV
DCLRHHSETEPQRSKALLSKLLKVFVKKFETIAKIQLPLIIQKCKGHAFSGALVNSSGNA
SLSHINAPDLKDDISNIQVSASGSQWIYSVNVAEFRSLVKTLVGGVKTITWGFFNSKFQL
TDTKLANHEKIFGPEIVCSYIDLVYYAMEALDIYTINVNPNQQRTSGLISRSKEEKEVLE
HFSGIFLMMHSQNFQEIFSTTINFLVERIYKNQSLQVIANSFLANPTTSPLFATVLVEYL
LNKMEEMGSNLERSNLYLRLFKLVFGSVSLFPVENEQMLRPHLHKIVNRSMELALISEEP
YNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLEGLNRLQSGFHKQHMRDLFVELCLTV
PVRLSSLLPYLPMLMDPLVSALNGSPTLISQGLRTLELCVDNLQPDFLYDHIQPVRAALM
QALWKTLRNQDNAALVAFRVLGKFGGGNRKMMVEPQALSYIINDKPTISIVTYFQEYETP
IDFPVDEAIKSAFRALGSNSTDQFYRRQSWEVIRCFLAAFISLDDEKHMLLKLFTHVDFV
ENKIMNWSTFQHKAGNETVRETHQTALIGMLVASATKDLRDSVCPVMAAVVRHYTMVAIA
QQAGPFPQKGYQATHGIDPMILIDALASCMGHEEKELCKPGIACMGIILDTATNIMGNKD
RACKLPIIQYLAEKMVSLCYDRPWYSKVGGCQAIQFLCKHMSLRALFQNLFNFLKAFMFV
LMDLEGDVSNGAIEITKSYMKSMLEICLTPINECYKNIDLKDLQAKATYEVIHELVRHIT
SPNTIVREESMVLLKHIGTIQSKTVSEVMDPHKDVLADIIPPKKHLLRHQPANAQIGLMD
GNTFCTTLEPRLFTIDLTNTYHKLFFHELLTLSEAEDATLAKLDCYKNVPNLIPLRTSAL
RALAACHYISDIGYKEKIINIIFKVMESDKSELQTTAFHCMKHFITGVTLEKEKVQSAMR
PLLLKLGDHRNLSIPAIKRLSYFTQIFPQMFNEKLSEQILQHCSKIMEIFVSEYKSTSPN
VNFFASSKGGEYEQKIVILIEMFFYISASVKYIEKLCQLVLKTEKNLMIEASSPYREALI
KFLQRFPTETVDLFLTESLMIDPQWNRLFIYLLKHETGVSFRAVIKSSRYNNLIHYLNTH
TEFPEALKYEIQHQAVLIIFTLMESDDQWIPTRQDIVDALKNCWQNYLSTLSSEDVLCDL
WHLIGKILLHYFSNNTNDIELLFQLLRALCFRFIPDVYFLRDFLQHTVAQSFTVNWKRNA
FFYFVENFNNSFLSEELKAKIITAVIIPCFAVSFDKGEGNKLIGAPPTPYQEDEKNIVSV
FINKVFDPDKQYDDAVRIALLQLACLLVERASQHIHDGDANNKRQGNKLRRLMTFAWPCL
LSKSSVDPTARYHGHLLLSHIIARLAIHKKIVLQVFHSLLKGHALEARSIVKQALDVLTP
AMPLRMEDGNTMLTHWTKKIIVEEGHAMQQLFHILQLIIRHYKVYFPVRHQLVQHLINYM
QRLGFPPTASIEHKKLAVDLAEVIIKWELHRIKDDRETKTDGTEEELIQESSVKRSGIDL
VETRKKSFDIIRETTVQGVGSHTKPDDILRSIDKSYCDTVLNFLIRLACQVNDPQAPILS
PGESLSRRCVMLLKMAMRPEIWPQPFDIKLNWLDKVLATVETPHHNLNNICTGIDFLTFL
TTILSPDQLVSIIRPVQRGLSLCIIHQNTRIVRLMHMFLTRIMAIFPPDTQHKHEDLDLL
YTAVSKMIAENLTSYEKSPQPNASSLFGTLMILKACTTNNASYIDRILVQFIRVLNHLTR
DHINTIGGNTVISQSPDSNALPLELLVLSLELIKNRIFVMSVEIRKLFIGTILVSLIEKS
TEVKIIKCIIKMLDEWIKTKEPNVMTQVPSIREKSALLVKLMQNVEKKFTDEIELNIQFL
EIINFIYRDEILKQTELTNKLEGAFLNGLRFQNPNVRSKFFEILDSSMRRRLHDRLLYII
CSQAWDTIGSHYWIKQCIELLILTANTMMQIQCSNEQFKIPSITSVIPVNSSETQENSFV
SFLSSHSESFDIIQTVDDKDDVYDIDLNADRKEDCQQILPNRRVTLVELVYKQAEFLEAN
RNIRTDQMLVATSQLCHIDTQLAQSVWLSMFPRIWSIFTEDQRCNITKELIPFLSSGTNV
NQKDCHPSTLNTFVESLTKCAPPIYIPPNLLAYLGKSHNLWHRAILVLEDMAVNQSMQSK
DIDGGENQFSDLDVQQSNNIFDSLSKMYSSMHEEDLWAGLWLKFAHYPETNIAVSYEQMG
FFEEAQGAYDLAMTKFKQDLSNGVVNTYVNSELLLWENHWMRCAKELNQWDILLDYAQTN
KDKNMFLILESSWRVPDWNLMKIALAKTEQCYLKHYGFKINLYKGYLSILHQEERQTGNI
ERYVEIASSLCIREWRRLPNIVSHIHLPYLQASQQIMELHEASQIHQGLAQSRNNSLHDM
KAIVKTWRNRLPIISDDLSHWSDIFTWRQHHYQIITQHLEQQSDQGSTMLGVHASAQAII
SFGKIARKHNLTGVCQETLSRIYTIPSVPIVDCFQKIRQQVKCYLQMPSTSGKNEINEAL
EVIESTNLKYFTGEMNAEFYALKGLLLAQIGRSEEAGKSFSVAAQLHDGLTKAWAMWGDY
MEQIFLKERKITLAVDALICYLQASRNQIESKTRKYIAKVLWFLSYDNNTKILISTLEKH
VAGIPPSYWLPWIPQLLCCLEQFEGDVILNLLSQIGRLYPQAVYFPIRTLYLTLKIEQRE
KHKTAEQAVKSSCSNIDGTTLSFGRGASHGNIPSINPIKATPPMWRCSKVMQLQREVHPT
ILSSLEGIVDQMVWFRESWTEEVLRQLRQGLIKCYAIAFEKRDTVQHSTITPHTLHFVKK
LGSTFGIGIENVPGSVTSSISNSAASESLARRAQVTFQDPVFQKMKEQFTNDFDFSKPGA
MKLHNLISKLKTWIKVLETKVKKLPTSFLIEDKCRFLSNFSQKTAEVELPGELLIPLSSH
YYVRIARFMPRVEIVQKNNTAARRLYIRGTNGKIYPYLVVLDSGLGDARREERVLQLKRM
LNYYLEKQKETSRRFLNITVPRVVPISPQMRLAEDNPNSISLLKIFKKCCQSMQVDYDMP
IVKYYDRLSEVQARGTPTTHTLLREIFSEIQWTMVPKTLLKHWALKTFLAATDFWHFRKM
LTLQLALAFLCEHALNLTRLNADMMYLHQDSGLMNISYFKFDVNDDKCQLNQHRPVPFRL
TPNVGEFITHFGITGPLSAAIVATARCFIQPNYKLSSILQTILRDEIIALQKKGFRECKL
IEGSEDRYSDGNCMEHSVNIVNSAVDIIMTRFNKISYFDSIENKKISVLVQSATNIDNLC
RMDPAWHPWL
Download sequence
Identical sequences Q8I8U7
FBpp0292385 NP_001097192.2.81976 FBpp0292385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]