SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292403 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0292403
Domain Number - Region: 432-559
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0102
Family beta-mannanase CBM 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292403   Gene: FBgn0033107   Transcript: FBtr0303340
Sequence length 563
Comment type=protein; loc=2R:join(2702699..2704064,2704122..2704234,2704298..2704510); ID=FBpp0292403; name=koi-PB; parent=FBgn0033107,FBtr0303340; dbxref=FlyBase:FBpp0292403,FlyBase_Annotation_IDs:CG18584-PB; MD5=21ab6e94478e0b2d8b75ce3afa0b3df8; length=563; release=r5.30; species=Dmel;
Sequence
MEVPTVRSPQREAEAIKVNMASIEQNIQKALTAEEYENILNHVNSYVQQLVELKMQQHSK
ELAPQQIELFVKLMKENLKQIMYKTELSEKDLSDLAIKLKLELQSSGGWQDGAKLSQANL
EEITKLIKAEVHLHESHYTIQLDRIDFASLLERILAAPALADFVDARISLRVGELEPKES
SGSSDAEVQIERLNREIAFIKLALSDKQAENADLHQSISNLKLGQEDLLERIQQHELSQD
RRFHGLLAEIENKLSALNDSQFALLNKQIKLSLVEILGFKQSTAGGSAGQLDDFDLQTWV
RSMFVAKDYLEQQLLELNKRTNNNIRDEIERSSILLMSDISQRLKREILLVVEAKHNEST
KALKGHIREEEVRQIVKTVLAIYDADKTGLVDFALESAGGQILSTRCTESYQTKSAQISV
FGIPLWYPTNTPRVAISPNVQPGECWAFQGFPGFLVLKLNSLVYVTGFTLEHIPKSLSPT
GRIESAPRNFTVWGLEQEKDQEPVLFGDYQFEDNGASLQYFAVQNLDIKRPYEIVELRIE
TNHGHPTYTCLYRFRVHGKPPAT
Download sequence
Identical sequences D4G7C7
FBpp0292403 FBpp0292403 FBpp0292403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]