SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292775 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292775
Domain Number 1 Region: 11-96,143-280,319-388
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.12e-22
Family WD40-repeat 0.018
Further Details:      
 
Domain Number 2 Region: 960-1201
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000455
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 
Domain Number 3 Region: 313-367,437-635
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000103
Family WD40-repeat 0.022
Further Details:      
 
Domain Number 4 Region: 790-918
Classification Level Classification E-value
Superfamily TPR-like 0.00000873
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0292775
Domain Number - Region: 1176-1383
Classification Level Classification E-value
Superfamily TPR-like 0.000379
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292775   Gene: FBgn0260933   Transcript: FBtr0303763
Sequence length 1458
Comment type=protein; loc=2L:complement(553937..554274,554336..555446,555510..557665,557722..557882,557943..558541,559563..559574); ID=FBpp0292775; name=rempA-PC; parent=FBgn0260933,FBtr0303763; dbxref=FlyBase:FBpp0292775,FlyBase_Annotation_IDs:CG11838-PC; MD5=62bdce64eb0bc4b7668bca5a2cafe58f; length=1458; release=r5.30; species=Dmel;
Sequence
MIVWGEPQRDVTYPVHATSQATALCWHPEKALLASGWEHGDIHVWFAGHREFASVNAPHK
AAIVLLQFSEQGGRMVTADAMGLVTGWRCDGQYQFLTMFSHDLREVLLLICFRLTVESEV
REEMANLAKAAVAGDENALDTLTNWRPRTAARSMTHSGVRDNHCFYACTQGGVVYYINQG
GACVEVMKCGSLPPIVQMLWHPRKDAVICLMEDLTVTLFLVESTGILTELDRVKMSGRGG
GRQGGIAWSGNSLAIITGDFFVRIWDIERSDNYLLKMDLPSGNQPGSSMTTLSNGTMSSS
NQFFSHDSSESSGVLRKTPKYGQLNGEMFTCLAYSSTGQTLCAGTSQGNVYTWKRSGSRL
VGAPEDAWQLTNISSVRGAIRSCEWGYNELAKPCMLVNCLSNVFMLKEQPLLAVHTRELW
AVQRSAKSVQLTHCSGREAIVQSEFAVTAMALSELSLVMSNGRSISSYSLQKVEKSLDEF
EEILQTVEGTTPTTESTTTPLSLKLLQTFAAECLALNLCNQNIFCLGSSDVFVYSVGGVV
LHRIQASDIEGKIIGMDLSGCYLSVFTMNGYVKAYDVSRHDPKLLFPSKSGHDIFDDFGE
FILVKCNSSGSHLAMVIASSNFTPISTLFCWDFERSNLLEYGLLEPETNAKKESSTSLPV
RIFWDAEEPRLLATEVKSMIQKTLPQKNSLQPSHFVQSKVVLLFYSEKGCLNVLETQSMS
PGCQLLNLCVPNVIRLKINTMEEQPLQDFVDLQQCNPVTRKQVLNFSLYVAEGNMDMAYR
SIRSIQSKVIWTNLAKMCVHTNRLDVAKVCMGHLEQARSVRALRQAIEDDDLETEAKVAV
LAIELGMIEEAKDLYRRCKRFDLLNKLLQSIGHLDEAVELAEAEDRIHLKHTYYQKAQEL
RERGDIKGALEYFEKTQNPAQNITQLLLENPGAMKRYIQTTSDPKLLKWWGQYIESSGDM
DAALAVYHKAEDWFSQVKILCYLGKISKADAIARQSGDRAACYHLARHYENVGKFQEAIM
FFTRAQTFSNAIRICKENDFQEELWTVASSSRQRDKAIAAAYFEECGNFKHAVELYHRAG
MLHKALEMAFESQQPEILEIIASDLAPDSDAELINRCADFFCSIEQFQKAVHLLAKTRHL
ERALGICSEKGVPVTEELSEMLTPEKGEFEEATRVHILVQLGEFLQQQGDYHSATKKFTQ
AGDKIRAMKSLLKSGNTDKIIFFANMSRQREVYIMAANYLQALDWQSDPQVLKHIVTFYT
KGQAFDSLANFYAICAQIEIEEFQDYGKALTAMQEASKCLEKLSHAQHVYNNLQRTVADV
KAILEIQQALREGDHQLVIGSCRSMLIKPELPPIRHAHILAMLIRALVYVKDYSEAGRAL
KELTVKDSTWSASGLLDRSIVHKIAQECHLEFDLIWNAGRQVTASTSGTAATGMSSTSGM
TTTDDDDADDEEITEELH
Download sequence
Identical sequences Q9VPR0
FBpp0292775 NP_608530.2.81976 FBpp0292775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]