SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292856 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0292856
Domain Number - Region: 67-239
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0565
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292856   Gene: FBgn0028581   Transcript: FBtr0303848
Sequence length 279
Comment type=protein; loc=X:complement(17035124..17035236,17035359..17035514,17035727..17035794,17036300..17036740,17036835..17036896); ID=FBpp0292856; name=mei-217-PC; parent=FBgn0028581,FBtr0303848; dbxref=FlyBase:FBpp0292856,FlyBase_Annotation_IDs:CG33935-PC; MD5=c63b92a048124161a0371470e0356b41; length=279; release=r5.30; species=Dmel;
Sequence
MFTVDASEGSSVVNETPLKSQFHDQKLVEHFCRQTQLLKLVQVSSGRFVANYMSSRRPED
LLAPIQLRLDFEYRQLLDISPQLLQLIVEEPLQFQEAVRYSVYGLIRSHLKDAGLKPIDI
NQLHAHWRLVGLPFTPGLQFEPRDQLTRLGLSQIRGILAAFTPQETLVLQSIWYCGSGCM
RNAIQTSSTDAPFCSSCSRPMSEYQKLRVTETYRILAVLPISAVQTPRVTNCLHRPKLVR
LRAHAHDCELKLGASYLITGYFASSASTYQLEACHLRIN
Download sequence
Identical sequences Q86B50
FBpp0292856 FBpp0292856 FBpp0292856 NP_001027069.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]