SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0292927 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292927
Domain Number 1 Region: 257-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000689
Family EGF-type module 0.024
Further Details:      
 
Domain Number 2 Region: 78-209
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000209
Family Spermadhesin, CUB domain 0.0069
Further Details:      
 
Weak hits

Sequence:  FBpp0292927
Domain Number - Region: 462-503
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000996
Family I set domains 0.085
Further Details:      
 
Domain Number - Region: 214-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00107
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292927   Gene: FBgn0262032   Transcript: FBtr0303928
Sequence length 521
Comment type=protein; loc=2L:complement(10096805..10096862,10096914..10097053,10097783..10098010,10126001..10126230,10127518..10127609,10127770..10127877,10136646..10137355); ID=FBpp0292927; name=CG42843-PB; parent=FBgn0262032,FBtr0303928; dbxref=FlyBase:FBpp0292927,FlyBase:FBpp0099459,FlyBase_Annotation_IDs:CG34048-PA,FlyBase_Annotation_IDs:CG42843-PB; MD5=07e5c0ff1628ab96044e5c7effdc72a4; length=521; release=r5.30; species=Dmel;
Sequence
MTLVRPSATIWLLTLLLPAVLPHQTPPDADQKFSLPAVPLPPPPPFQPGKNHFALNAFAG
GEHAAGGHSHSSYSSSSPGCGGMLKARHGNIQTPNFPHRFATPIECVWIIDASDMPPQGQ
ANVSIVVYLTQLYVLSGLKFTEYMYYSDDFKVPAHRVFTLTEDDVTQVTWVKFHSQYLEI
RFTMATLDGTHLRALDRLLDVYGFNITYEVQNEVKTTQCNTLQCRFLGDCYASEDYSSYG
CSCFPGFSGSDCGHGPLCKDLHTNVCQNGGTCKHIGDAAITCHCPKGFKGTRCEIPEINE
TTQGCTSNSSSIECHQACDFDNFGRSISPPGQSYSASKGNRNAARSGKTRYEVTMRLGAN
LTGYYRHADREQLSGVMERQLGRVLRNFNITKISDLELISNSTDRLDITFHFFGVKGDSQ
RIRDAITRMVERGRIGNFTLVANFHHFDENPPLGLLELTVNQPQSGVREASEFIISCTAQ
GSSRMQFQWFKDGAVVNASKSTSSKCHKLAARVMEYGMRME
Download sequence
Identical sequences FBpp0292927 FBpp0292927 FBpp0292927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]