SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0293029 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293029
Domain Number 1 Region: 393-560
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.24e-38
Family Ankyrin repeat 0.00021
Further Details:      
 
Weak hits

Sequence:  FBpp0293029
Domain Number - Region: 221-266
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0374
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293029   Gene: FBgn0262111   Transcript: FBtr0304067
Sequence length 1790
Comment type=protein; loc=X:join(17143835..17144766,17156673..17157011,17163964..17164147,17165255..17165437,17165521..17166738,17166925..17167381,17167545..17167865,17171648..17172176,17172984..17173344,17173452..17173700,17173766..17173974,17174043..17174433); ID=FBpp0293029; name=f-PH; parent=FBgn0262111,FBtr0304067; dbxref=FlyBase:FBpp0293029,FlyBase_Annotation_IDs:CG42864-PH; MD5=d57df59b58adeedea7aead648974c21d; length=1790; release=r5.30; species=Dmel;
Sequence
MRDLKQRLFDLLRSGGNNNSSSSNNSGSNGCNSNTNNSSNSHQNKSNNQQTYAPPAHKPK
KLHEYTAADCNAAFLRKYHDLSISRDREMDRDRERDRERERAGPGQVQSPNVIYFNENLS
MASKYNVRPFPLARYPSCPLSSFGLSPGSGRPEGSAGSSLGEEEDTESEPYHFCSDEDHS
SHTQTIKLRRHQHGHHGHHGLDLMEPSVNEDADLEDDQAESQLDSFCTLCTSTFSYNKCC
RFCENSLCGSKCNSERGSHASRMSRISQISRNLDGGYPPDPDLESHQNQLQPHRFGGSMR
MLAHHQSAAIRTINDYALNSNLHLSHNTKLNNLHSNKLLHSNQSHSSSINPSTRMHSHQL
DSYLGGVGSMMNLGGMGQVGQMYHPGSVSGSERPNGGALALHYAAARGCLDCVQLLVAAS
VDICANTQMDNDVTPVYLAAQEGHLEVLKFLVLEAGGSLYVRARDGMAPIHAASQMGCLD
CLKWMVQDQGVDPNLRDGDGATPLHFAASRGHLSVVRWLLNHGAKLSLDKYGKSPINDAA
ENQQVECLNVLVQHGTSVDYNGKSSSQRHKSQQQLHQQHQQQQQQQQQQHLSSSCNSNSN
SSKQTSRSNTIKSKSSSTLSSDVEPFYLHPPALAGGSGGSGMGLGMGMGMGMGMSMGLGI
SRKNSDALYSQQSRSSSEKLYNGSSSLGGNPGGNSSSGGGGVGGGGGSGGALLPNDGLYV
NPMRNGGMYNTPSPNGSISGESFFLHDPQDIIYNRVRDLFVDSDCSSSVKQHGKSHAHQL
LQSKAGNAMTIQADVHSSSSGAGSGSDESVSISSSFNSPKQQQQLRSQSFNRHGSSSNIS
ASGNIKNNNYKAHKGKPSNQNGGGDHDYEDIYLVREESRKQHQQQQQHQLQQQQQLQHQA
TQQQQQQQQQQQQLQHKYNVGRSRSRDSGSHSRSASASSTRSTDIVLQYSNHHLNNKRNM
NNNSNMNNSSSNIAQSSSSNNNNNSLLNRNKSHSIIGLHSSKYESSLKDNYSAKNVNLKN
QLLNGGIKSDTYESVCPPEDVAERTKQTHKNSMIRNNLADASSNNNTSGSINNISNIGNM
NGGNQSSRNLKRVSSAPPMQNLAVVNGPPPPPLPPPLRAPVQQQRNNLSVDQPNSMTGNN
GIYKKNVFGPNQGPTNANGTGGAAPPPVPAPNPVATEAVDSDSGLEVVEEPSLRPSELVR
GNHNRTMSTISANKKAKLLNAGSTNGSSIAASSDDSQSRYGGSVHAANGSAANGHFYGYS
EGNKNQGSNGNGNGNGNGGGGNYHSHPNQPHYATGQPHQYTPSLYGGGSSAEDHYELTQQ
QQQIYGETHLPSGQRTGGPNLVNKQLVLPFVPPSFPNKSQDGVTHLIKPSEYLKSISIDK
RSCPSSARSTDTEDYMQIQIAQQQSHPHQHQHHPHPHPHPHHPHQLHGMGEQPPLPPPPP
PLPHGMLPPQPPMGPPMGVAGGQDATMSGKSHKPKKPHGSAPNSQDTATRKQHQPLSAIS
IQDLNSVQLRRTDTQKVPKPYQMPARSLSMQCLTSSTETYLKSDLIAELKISKDIPGIKK
MKVEQQMASRMDSEHYMEITKQFSGNNYVDQIYLQIPERDQAGNAIPDWKRQMMAKKAAE
RAKKDFEERMAQEAESRRLSQIPQWKRDLLARREETENKLKAAIYTPKVEENNRVADTWR
LKNRAMSIDNININLAGMEQHYQQIQFQQKQQQLQLGNKENHVDPKGADQDQEHGVGIGS
GVGNANSGVIGGQELIDPSEGSQGRAEEEEDNIIPWRAQLRKTNSRLSLI
Download sequence
Identical sequences M9MSB2
NP_001188658.1.81976 FBpp0293029 FBpp0293029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]