SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070750 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070750
Domain Number 1 Region: 300-440
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.63e-34
Family BCR-homology GTPase activation domain (BH-domain) 0.000021
Further Details:      
 
Domain Number 2 Region: 81-172
Classification Level Classification E-value
Superfamily SH2 domain 5.65e-21
Family SH2 domain 0.00035
Further Details:      
 
Domain Number 3 Region: 233-294
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.89e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070750   Gene: FBgn0029778   Transcript: FBtr0070784
Sequence length 440
Comment type=protein; loc=X:complement(5511058..5511061,5511154..5511259,5511342..5511819,5511891..5512513,5512599..5512710); ID=FBpp0070750; name=RhoGAP5A-PB; parent=FBgn0029778,FBtr0070784; dbxref=FlyBase:FBpp0070750,FlyBase_Annotation_IDs:CG3208-PB,GB_protein:AAN09145.1,REFSEQ:NP_572235,GB_protein:AAN09145,FlyMine:FBpp0070750,modMine:FBpp0070750; MD5=28ce52fdfa902b94335087b03755e9c7; length=440; release=r5.30; species=Dmel;
Sequence
MPRNTEAGAGNANTGGSGGVGGAPEPSSPVQKVWKPELYKLQLEAPAPCPLRCQRTLPLP
PAKSTAEAVEANNLAGRLYGSEYHGLMGHLEAEQLLANARDGSYFVRRSPQSDGYYTLSL
RFNKRPKHYKLLYKPGVGHYLRGQDKRFDTVHDMVADGLINFHMQLHASPIIQQINQQTK
NCYQQSPYMTLNGRKLRALSNELGKAAAKESKESPAEEKEQKQEEPPPPAVDPMPLVYEK
PHHFKVHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCVPDLKRIRG
VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREG
EKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAV
RRLPPAHHSCLQYMLEHLKR
Download sequence
Identical sequences Q961S1
FBpp0070750 NP_572235.1.81976 FBpp0070750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]