SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071729 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071729
Domain Number 1 Region: 482-755
Classification Level Classification E-value
Superfamily L domain-like 1.47e-40
Family Ngr ectodomain-like 0.044
Further Details:      
 
Domain Number 2 Region: 312-571
Classification Level Classification E-value
Superfamily L domain-like 4.42e-35
Family Internalin LRR domain 0.059
Further Details:      
 
Weak hits

Sequence:  FBpp0071729
Domain Number - Region: 800-914
Classification Level Classification E-value
Superfamily ARM repeat 0.00518
Family MIF4G domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071729   Gene: FBgn0013272   Transcript: FBtr0071816
Sequence length 1076
Comment type=protein; loc=2R:join(18210475..18210530,18212680..18213232,18213288..18213842,18213901..18215635,18215698..18216029); ID=FBpp0071729; name=Gp150-PD; parent=FBgn0013272,FBtr0071816; dbxref=FlyBase:FBpp0071729,FlyBase_Annotation_IDs:CG5820-PD,GB_protein:AAM68221.1,REFSEQ:NP_477049,GB_protein:AAM68221,FlyMine:FBpp0071729,modMine:FBpp0071729; MD5=0c391556aabd1bb49345f472e1b2b99d; length=1076; release=r5.30; species=Dmel;
Sequence
MHNLITGPHLLSNPHDISGLPIYRKMSRQSTCRLVLLLAFTLALIHASHSNTVGPKIHFI
HDDLTENELNSGEEVSPTESLPKISTPKVKDLPVETTTRSPTKKTTSSGTEKSLSEEAWN
DLMEAAKHSQALADDPHFNKMLNTTVAAGEKNSTDTDDSEYYDYDDDYNYFDEETVTISP
SPKKAKSNPKLQPIVDATITKSKSKSNDQKTKESANDIDSDSQYDYDEGLDDDDDEDDAA
DDLLTDDEQVVFSEDVPCPRFCQCARNVNSYLVATCSRLDMGIQKFGSDITDLVVTNVGP
KYPILMGPNFFQNLGLKNVASIKIANCTLEYLHAEAFHGLNELYAVNLTDVGLAIINPDT
FVGNKKLRMLTISGNDLSVMSSIHYLLKSSSIEELDFSRNNLMELNPKAFSHLSNVVYIN
LSQNSLKKLPEKAFEKVTLLEELDLSYNSLTELPRDIFNGTTLSILHLKYNTFNGDLHFG
TKDLQQLDLSFNSIVQVHHSMFDKMPGLTNLNLKGNGIKKIQPDSFLTLKNLRHIDLSIN
DLDQISGMLFFKNSELDVIRLNDNPRLSQLPTDGFLSYSGEFTVYYLDISNCAIGPLGHK
AFSTMPHLTTLKLAWNNINHLPREIFTGLHKLIDLDLSNNLITRMDDLIFMDNGELTKLS
LAGNPISRLSVRLFLPLHQLRCLDVNDCELTTLLSDRDLGAGYKIFDSLRSFNASGNLIK
KISSEDVKSFKNLRSLDITNNPLKCTPDFQEFISYVTLQMQMTPKRLPVLANLEDDATIV
QLETLAQAGWSSLAHEVCKHAEGSDLLDEKKADSAEAKLEKRLKESVKKLNEDEAKLLSV
LDKSVLDKSRLSSMQKIMKGSVNTETAKPEEDADEENLNNGGEDKEDDSSDYDSEEDDDD
DDEDDDDDNNDDDRFEEAKKNAKAKADANKAFDTFVNKELKPVLKTDGIQAEEVDMSQET
RDKFLLEKLGFDSESEESDEYTEKMIFHGELSYDLVVPLIVVSFCLLMIVLSIARVIYVV
LRKRGERYRMALLASKNSFVYQKLSEDIVKPTSKEQKEPKHLKQPKVHRYAPINQV
Download sequence
Identical sequences Q8MLT4
FBpp0071729 FBpp0071729 7227.FBpp0071729 FBpp0071727 NP_477049.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]