SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072827 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072827
Domain Number 1 Region: 36-240
Classification Level Classification E-value
Superfamily L domain-like 3.35e-37
Family Ngr ectodomain-like 0.0073
Further Details:      
 
Domain Number 2 Region: 235-327
Classification Level Classification E-value
Superfamily Immunoglobulin 7.34e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 363-453
Classification Level Classification E-value
Superfamily Immunoglobulin 8.04e-17
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072827   Gene: FBgn0011828   Transcript: FBtr0072950
Sequence length 457
Comment type=protein; loc=3L:complement(2610486..2611159,2611316..2611557,2611639..2611710,2611788..2612003,2629141..2629310); ID=FBpp0072827; name=Pxn-PB; parent=FBgn0011828,FBtr0072950; dbxref=FlyBase:FBpp0072827,FlyBase_Annotation_IDs:CG12002-PB,GB_protein:AAN11518.1,REFSEQ:NP_728759,GB_protein:AAN11518,FlyMine:FBpp0072827,modMine:FBpp0072827; MD5=682d71b1737354c63f0cd3d2fa97ec12; length=457; release=r5.30; species=Dmel;
Sequence
MRFMLLMLQLLGLLLLLAGGVQSVYCPAGCTCLERTVRCIRAKLSAVPKLPQDTQTLDLR
FNHIEELPANAFSGLAQLTTLFLNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIF
QRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLD
GNAIDCNCGVYSLWRRWHLDVQRQLVSISLTCAAPQMLQNQGFSSLGEHHFKCAKPQFLV
APQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSADTS
DMGIYQCIARNEMGALRSQPVRLVVNGGNHPLDSPIDARSNQVWADAGTPMHGATPLPSP
LPSPPHFTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQWFVNGRQLLQSTPSLQLQANG
SLILLQPNQLSAGTYRCEARNSLGSVQATARIELKGE
Download sequence
Identical sequences FBpp0072827 FBpp0072827 NP_728759.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]