SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073147 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073147
Domain Number 1 Region: 362-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000346
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 2 Region: 332-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000137
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  FBpp0073147
Domain Number - Region: 425-496
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073147   Gene: FBgn0035539   Transcript: FBtr0073291
Sequence length 512
Comment type=protein; loc=3L:join(4390491..4391221,4401900..4402156,4402225..4402643,4402712..4402843); ID=FBpp0073147; name=slow-PA; parent=FBgn0035539,FBtr0073291; dbxref=FlyBase:FBpp0073147,FlyBase_Annotation_IDs:CG7447-PA,GB_protein:AAF47894.2,REFSEQ:NP_647898,GB_protein:AAF47894,FlyMine:FBpp0073147,modMine:FBpp0073147; MD5=e698a5e117ae06f1573b1de5daeb17ba; length=512; release=r5.30; species=Dmel;
Sequence
MPEMIYSSSFLLLCCTILLLGTVQNAGSNSTSPHPHQNQTHRGHGHSHRTRHQGNYLATH
QRQQRRLQSLNQAKSDVELLPGVTMHEVTRLRRVQPHNPYNKVQTRRLHQSRNPTEWDYN
TYNIMTNTFGPPPPPMPLSPRYGKGEDNTQDVEFIGVRERGRGYSFVPSVTVTTAPPPNL
NRRSASPGSRSSIGTIPPLVPARRGYSYTTTTSSPPVNTITTDNPFETNTIGRGYPTDPK
EMERRHICMQQRTVTMPVKRTEVYSRPTWKHVATPCQPPTFSGQKCTRVQVVHEQAYRDV
IDHKTAQQMTYDCCTGWSRENPRSDSCMKPICSARCQNGGNCTAPSTCSCPTGFTGRFCE
QDVDECQTEKPCDQQCINTHGSYFCRCRQGFVLQSDQQSCKKVSTNADDAFEARDLENDI
DDTDAEVATRLQKIEKSLANERVHTNELQKSLQATYSVVDTLKSRLSTLEKQAQDVSRLQ
TNLYKTESRTNKLEGMLNLLLKCRNGPNANCP
Download sequence
Identical sequences Q95RQ1
FBpp0073147 FBpp0073148 FBpp0073147 FBpp0073148 7227.FBpp0073148 NP_647898.3.81976 NP_788461.1.81976 FBpp0073147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]