SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073239 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073239
Domain Number 1 Region: 13-131
Classification Level Classification E-value
Superfamily L domain-like 4.76e-25
Family U2A'-like 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073239   Gene: FBgn0030247   Transcript: FBtr0073383
Sequence length 365
Comment type=protein; loc=X:10794562..10795659; ID=FBpp0073239; name=CG15208-PA; parent=FBgn0030247,FBtr0073383; dbxref=FlyBase:FBpp0073239,FlyBase_Annotation_IDs:CG15208-PA,GB_protein:AAF47974.1,REFSEQ:NP_572664,GB_protein:AAF47974,FlyMine:FBpp0073239,modMine:FBpp0073239; MD5=c281cad15aa003243362faf3aa719a2f; length=365; release=r5.30; species=Dmel;
Sequence
MEKQLTEHMVESMSRCRDYAKALKLNFCNCGLNDISLCLKMPYLEVLSLSMNKITSLKSL
VRCTRLKELYLRQNEIADFDELKYLVNAKSLTSLWLLDNPCSIAAGSNYRASVLRMLPNL
KKLDNVDVAEEELESALRYDYYPDVGSAILNPVLDLSNCSPDDMAYRDMIEQCDRTIRQV
QQQQRKRFASGDAKNIDELARIRSRSVLVNGERLPLFFPSDLRQVRQAQKAQDALRKQKN
QPIWHNEQVQQAHKFTMTPQAVHEQVQGIQSISSDRNADSPAASTSTLAENLIELINSRR
QDVVTPPGHLLPNVSSGLALNGANSTTLERHNNSLSAALLLIQDMNASQLETLVLAIIEQ
FVQLN
Download sequence
Identical sequences Q9VZ54
FBpp0073239 7227.FBpp0073239 FBpp0073239 FBpp0073239 NP_001285099.1.81976 NP_001285100.1.81976 NP_572664.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]