SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073584 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073584
Domain Number 1 Region: 96-189
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.31e-25
Family Hormone receptor domain 0.0012
Further Details:      
 
Domain Number 2 Region: 164-462
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000011
Family Rhodopsin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073584   Gene: FBgn0030437   Transcript: FBtr0073753
Sequence length 486
Comment type=protein; loc=X:complement(12845337..12845716,12845780..12845853,12845978..12846096,12846340..12846441,12846535..12846661,12846763..12846854,12846920..12847010,12847566..12847866,12848398..12848572); ID=FBpp0073584; name=CG4395-PA; parent=FBgn0030437,FBtr0073753; dbxref=FlyBase:FBpp0073584,FlyBase_Annotation_IDs:CG4395-PA,GB_protein:AAF48216.1,GB_protein:AAF48216,REFSEQ:NP_572843,GB_protein:AAF48216,FlyMine:FBpp0073584,modMine:FBpp0073584; MD5=8b03fe0ce257baf13cd0e7023adbd3e0; length=486; release=r5.30; species=Dmel;
Sequence
MATTSSDSESQNVDVASQAQTQDNLRIFLKHLYAECVFRYQNVTYDTDDPSFSLGPATDY
DSDLPENFSPVPRYLENAAMNEGVIDMRNVDEELAEKEELMATVVSATMATNQKENRLFC
PLNFDGYLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHKTCLENGSWYRHPVSNQTWSNYT
NCVDYEDLEFRQFINELYVKGYALSLLALLISIIIFLGFKSLRCTRIRIHVHLFASLACT
CVAWILWYRLVVERSETIAENPLWCIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVK
DTIVMRWFIVISWFSPIPIAIVYGLARHFSSPDNKHCWITDSLYLWIFSVPITLSLLASF
IFLINVLRVIVRKLHPQSAQPAPLAIRKAVRATIILVPLFGLQHFLLPYRPDAGTQLDHF
YQMLSVVLVSLQGFVVSFLFCFANHDVTFAIRTLLNKLLPSLVTPPPAGSNTGQMATTTP
SRELGV
Download sequence
Identical sequences Q9VYH9
FBpp0073584 FBpp0073584 NP_001285174.1.81976 NP_572843.2.81976 7227.FBpp0073584 FBpp0073584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]