The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0073759 |
| Domain Number 1 |
Region: 646-725 |
| Classification Level |
Classification |
E-value |
| Superfamily |
TIMP-like |
7.46e-16 |
| Family |
Netrin-like domain (NTR/C345C module) |
0.061 |
| Further Details: |
|
| |
| Domain Number 2 |
Region: 313-371 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.000000000502 |
| Family |
Laminin-type module |
0.02 |
| Further Details: |
|
| |
| Domain Number 3 |
Region: 369-425 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.00000000259 |
| Family |
Laminin-type module |
0.025 |
| Further Details: |
|
| |
| Domain Number 4 |
Region: 432-472 |
| Classification Level |
Classification |
E-value |
| Superfamily |
EGF/Laminin |
0.00000019 |
| Family |
Laminin-type module |
0.016 |
| Further Details: |
|
| |
| Sequence: |
FBpp0073759 |
| Domain Number - |
Region: 531-566 |
| Classification Level |
Classification |
E-value |
| Superfamily |
TIMP-like |
0.000165 |
| Family |
Tissue inhibitor of metalloproteinases, TIMP |
0.04 |
| Further Details: |
|
| |
| Domain Number - |
Region: 99-172 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Galactose-binding domain-like |
0.00867 |
| Family |
Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) |
0.038 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Cellular Component |
IC (bits) |
H-Score |
| Molecular Function |
IC (bits) |
H-Score |
| Biological Process |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0073759 Gene: FBgn0015773 Transcript: FBtr0073942 |
| Sequence length |
726 |
| Comment |
type=protein; loc=X:complement(14498519..14498660,14498779..14499157,14500516..14500581,14504472..14504624,14504694..14504843,14514733..14514921,14546176..14547277); ID=FBpp0073759; name=NetA-PA; parent=FBgn0015773,FBtr0073942; dbxref=FlyBase_Annotation_IDs:CG18657-PA,FlyBase:FBpp0073759,GB_protein:AAF48380.3,REFSEQ:NP_511154,GB_protein:AAF48380,FlyMine:FBpp0073759,modMine:FBpp0073759; MD5=f81b86e41da59643d91013f195ccbfd6; length=726; release=r5.30; species=Dmel; |
| Sequence |
MIRGILLLLLGTTRFSPIQCISNDVYFKMFSQQAPPEDPCYNKAHEPRACIPDFVNAAYD
APVVASSTCGSSGAQRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEP
VTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCR
RLFGRPARQSTGRHNEHEARCSDVTRPLVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATD
IRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGL
HYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATA
KEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDAT
KPLTHRKVCKACDCHPIGSSGKICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCI
KQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVST
KRLNLNKFCKRDYAIMAKVIGRDTSSEAVSREVQRRAMDPDVADYEMDQVQPGSARSPIT
GVYEFQAADYPNPNPNPRGSEMERFDLQIQAVFKRSRPGESSGAGNVYGMPNTTLKRGPM
TWIIPTKDLECRCPRIRVNRSYLILGRDSEAPPGYLGIGPHSIVIEWKEDWYRRMKRFQR
RARTCA
|
| Download sequence |
 |
| Identical sequences |
Q24567 X2JEZ9
FBpp0073759 7227.FBpp0073759 FBpp0073759 NP_001285243.1.81976 NP_511154.3.81976 FBpp0073759 |
