SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073759 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073759
Domain Number 1 Region: 646-725
Classification Level Classification E-value
Superfamily TIMP-like 7.46e-16
Family Netrin-like domain (NTR/C345C module) 0.061
Further Details:      
 
Domain Number 2 Region: 313-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 3 Region: 369-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000259
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 4 Region: 432-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000019
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0073759
Domain Number - Region: 531-566
Classification Level Classification E-value
Superfamily TIMP-like 0.000165
Family Tissue inhibitor of metalloproteinases, TIMP 0.04
Further Details:      
 
Domain Number - Region: 99-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00867
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073759   Gene: FBgn0015773   Transcript: FBtr0073942
Sequence length 726
Comment type=protein; loc=X:complement(14498519..14498660,14498779..14499157,14500516..14500581,14504472..14504624,14504694..14504843,14514733..14514921,14546176..14547277); ID=FBpp0073759; name=NetA-PA; parent=FBgn0015773,FBtr0073942; dbxref=FlyBase_Annotation_IDs:CG18657-PA,FlyBase:FBpp0073759,GB_protein:AAF48380.3,REFSEQ:NP_511154,GB_protein:AAF48380,FlyMine:FBpp0073759,modMine:FBpp0073759; MD5=f81b86e41da59643d91013f195ccbfd6; length=726; release=r5.30; species=Dmel;
Sequence
MIRGILLLLLGTTRFSPIQCISNDVYFKMFSQQAPPEDPCYNKAHEPRACIPDFVNAAYD
APVVASSTCGSSGAQRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEP
VTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCR
RLFGRPARQSTGRHNEHEARCSDVTRPLVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATD
IRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGL
HYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATA
KEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDAT
KPLTHRKVCKACDCHPIGSSGKICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCI
KQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVST
KRLNLNKFCKRDYAIMAKVIGRDTSSEAVSREVQRRAMDPDVADYEMDQVQPGSARSPIT
GVYEFQAADYPNPNPNPRGSEMERFDLQIQAVFKRSRPGESSGAGNVYGMPNTTLKRGPM
TWIIPTKDLECRCPRIRVNRSYLILGRDSEAPPGYLGIGPHSIVIEWKEDWYRRMKRFQR
RARTCA
Download sequence
Identical sequences Q24567 X2JEZ9
7227.FBpp0073759 NP_001285243.1.81976 NP_511154.3.81976 FBpp0073759 FBpp0073759 FBpp0073759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]