SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074242 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074242
Domain Number 1 Region: 214-284
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000683
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074242   Gene: FBgn0030873   Transcript: FBtr0074468
Sequence length 321
Comment type=protein; loc=X:complement(17742674..17742794,17742852..17743087,17743150..17743378,17743447..17743743,17743809..17743843,17743941..17743988); ID=FBpp0074242; name=CG15814-PB; parent=FBgn0030873,FBtr0074468; dbxref=FlyBase:FBpp0074242,FlyBase_Annotation_IDs:CG15814-PB,GB_protein:AAN09594.1,REFSEQ:NP_728098,GB_protein:AAN09594,modMine:FBpp0074242; MD5=2b92d522cbd287c04e5c1e2ec9c0cbcb; length=321; release=r5.30; species=Dmel;
Sequence
MHQEHMDLHEPVDLNKSLDEMTPEERMRAQHQLMVEKHRGHDAMHSEMVIILFVTLVIAQ
IILVEWKKRHYRSYAFVTLLAMWLIPLIISCSFGWLRFIIIWLVFTCITALVMRRAISKP
IQGTTPRLVYKWFYFIYKLSYGLGLVGYLVIIAAFLGMNYMFSQPPNTWMDVGLMFCFYG
LYIGVLGRDISEICSDKMAAAIGYYTPQGIPTRHLDQNVCAVCGNQLLVSEKEEGVIENT
YKLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLQKMFRNPWEKPHVLYGRLLDWIRWL
VAWQPLIFFIVQGINWMLGLE
Download sequence
Identical sequences Q9VX13
NP_573247.2.81976 NP_728098.1.81976 NP_728099.1.81976 7227.FBpp0074242 FBpp0074243 FBpp0074242 FBpp0074243 FBpp0074244 FBpp0074242 FBpp0074243 FBpp0074244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]