SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074476 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074476
Domain Number 1 Region: 46-280
Classification Level Classification E-value
Superfamily L domain-like 1.22e-36
Family Ngr ectodomain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 279-380
Classification Level Classification E-value
Superfamily Immunoglobulin 5.88e-16
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074476   Gene: FBgn0031016   Transcript: FBtr0074707
Sequence length 931
Comment type=protein; loc=X:join(19358703..19360254,19362340..19363583); ID=FBpp0074476; name=kek5-PB; parent=FBgn0031016,FBtr0074707; dbxref=FlyBase:FBpp0074476,FlyBase_Annotation_IDs:CG12199-PB,GB_protein:AAN09488.1,REFSEQ:NP_728242,GB_protein:AAN09488; MD5=0979d23287101a43b651a85b03be5109; length=931; release=r5.30; species=Dmel;
Sequence
MMGNRTERSGRRLGMILLLLGVLVVLMALPPPTAGTTDWMQSCGTCHCQWNSGKKSADCK
NKALTKIPQDMSNEMQVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFK
GLHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRN
NRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDF
RDFAISKRLYTPPTDCQEPPQLRGKLWSEVPSENFACRPRILGSVRSFIEANHDNISLPC
RIVGSPRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAY
TCVADNRGGRAEAEFQLLVSGDYAGAVSASDGMGMGAIGAPTIDPQTNMFLIICLIITTL
LLLLLVAVLTLFWYCRRIKTYQKDTTMMSGDGLISSKMDKTHNGSMLEGSVIMEMQKSLL
NEVNPVEKPPRRTDIESVDGGDDVLEIKKTLLDDTVYVANHSRDEEAVSVAMSDTTTTPR
SRHTYVDDAYANSLPPDLLAFPARVPPTSPSMQSSQSNIPDQVIYGIRSPPSLTSPVYTH
MTPHGIYGTKTMTAPHNGFMTLQHPKSRNLALIATTNSSRQHQHHHQLQQQQQHHHHHQQ
QQQQQQQQQHPLATTSPFLPAPVVYSPATGVVMKQGYMTIPRKPRAPSWAPSTSGAAGHG
SIQLSEFQSPTSPNPSETGTATTAELQAEPVYDNLGLRTTAGGNSTLNLTKIAGSQGGAG
QQYSMRDRPLPATPSLTSVSSATNASKIYEPIHELIQQQQQLQQQQQQQQQRLGSMDTEP
LYGVRQQGITILPGSSISGAGLGHAAYLSPGSGAAVSPSHASSSGDSPKAAKIPPRPPPK
PKKKMSVTTTRSGQGSTSQLFDDEGEDGTEV
Download sequence
Identical sequences Q9VWI6
FBpp0074476 FBpp0074477 FBpp0301162 FBpp0301163 NP_001245746.1.81976 NP_573382.1.81976 NP_728242.1.81976 NP_728243.1.81976 7227.FBpp0074476 FBpp0074476 FBpp0074476 FBpp0074477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]