SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074722 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074722
Domain Number 1 Region: 177-485
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.45e-33
Family NodB-like polysaccharide deacetylase 0.026
Further Details:      
 
Domain Number 2 Region: 52-115
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000201
Family Tachycitin 0.011
Further Details:      
 
Domain Number 3 Region: 130-166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074722   Gene: FBgn0261341   Transcript: FBtr0074954
Sequence length 549
Comment type=protein; loc=3L:complement(19683606..19684756,19684909..19685058,19685365..19685477,19686083..19686194,19686600..19686671,19688073..19688124); ID=FBpp0074722; name=verm-PB; parent=FBgn0261341,FBtr0074954; dbxref=FlyBase:FBpp0074722,FlyBase_Annotation_IDs:CG8756-PB,GB_protein:AAF49122.1,REFSEQ:NP_730443,GB_protein:AAF49122,FlyMine:FBpp0074722,modMine:FBpp0074722; MD5=e4e926c9f5cc5da230aedefcf4160443; length=549; release=r5.30; species=Dmel;
Sequence
MARWWPILSVVCLCLAVDGLYVKNSFEPAIDQDPSRRYQRKPHGQDKLEGVDVEEVCADR
PADEYFRLETDGDCREVYRCTKSGLKEIQCPSGLAFDVIKQTCDWKAKVTNCDEKEKPRK
AKPILKTDEPICPEGKLSCGDGECLDKELFCNGKSDCKDESDENACSVDEDPNRAPECDP
TQCALPDCFCSADGTRIPGGIEPQQVPQMITITFNGAVNVDNIDLYEDIFNGQRQNPNGC
SIKGTFFVSHKYTNYSAVQDLHRRGHEISVFSLTHKDDPNYWTGGSYDDWLAEMAGSRLI
VERFANITDGSIIGMRAPYLRVGGNKQFEMMADQFFVYDASITASLGRVPIWPYTLYFRM
PHKCNGNAHNCPSRSHPVWEMVMNELDRRDDPTFDESLPGCHMVDSCSNVASGDQFARLL
RHNFNRHYNSNRAPLGLHFHASWLKSKKEYRDELIKFIEEMLGRNDVFFVTNLQVIQWMQ
NPTELNSLRDFQEWKEKCDVKGQPYCSLPNACPLTTRELPGETLRLFTCMECPNNYPWIL
DPTGDGFSV
Download sequence
Identical sequences FBpp0074722 FBpp0074722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]