SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074724 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074724
Domain Number 1 Region: 158-467
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.22e-33
Family NodB-like polysaccharide deacetylase 0.026
Further Details:      
 
Domain Number 2 Region: 28-97
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000141
Family Tachycitin 0.017
Further Details:      
 
Domain Number 3 Region: 112-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074724   Gene: FBgn0261341   Transcript: FBtr0074956
Sequence length 531
Comment type=protein; loc=3L:complement(19683606..19684756,19684909..19685058,19685821..19685951,19686083..19686194,19688073..19688124); ID=FBpp0074724; name=verm-PC; parent=FBgn0261341,FBtr0074956; dbxref=FlyBase:FBpp0074724,FlyBase_Annotation_IDs:CG8756-PC,GB_protein:AAF49123.2,REFSEQ:NP_730441,GB_protein:AAF49123,FlyMine:FBpp0074724,modMine:FBpp0074724; MD5=7260ee9b04d3410c43e16f94cd729b97; length=531; release=r5.30; species=Dmel;
Sequence
MARWWPILSVVCLCLAVAHGQDKLEGVDVEEVCADRPADEYFRLETDGDCREVYRCDSAG
EDGTWRLAPIRCAGGLAFDVLRQLCDWKSNVKSCDVLEKPRKAKPILKTDEPICPEGKLS
CGDGECLDKELFCNGKSDCKDESDENACSVDEDPNRAPECDPTQCALPDCFCSADGTRIP
GGIEPQQVPQMITITFNGAVNVDNIDLYEDIFNGQRQNPNGCSIKGTFFVSHKYTNYSAV
QDLHRRGHEISVFSLTHKDDPNYWTGGSYDDWLAEMAGSRLIVERFANITDGSIIGMRAP
YLRVGGNKQFEMMADQFFVYDASITASLGRVPIWPYTLYFRMPHKCNGNAHNCPSRSHPV
WEMVMNELDRRDDPTFDESLPGCHMVDSCSNVASGDQFARLLRHNFNRHYNSNRAPLGLH
FHASWLKSKKEYRDELIKFIEEMLGRNDVFFVTNLQVIQWMQNPTELNSLRDFQEWKEKC
DVKGQPYCSLPNACPLTTRELPGETLRLFTCMECPNNYPWILDPTGDGFSV
Download sequence
Identical sequences A0A0J9RY67 B3NIH7 B4PFZ1 Q9VW31
FBpp0074724 FBpp0074724 NP_730441.1.81976 XP_001973376.2.56816 XP_002095576.2.41174 XP_016032538.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]