SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075105 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075105
Domain Number 1 Region: 318-605
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.55e-16
Family WD40-repeat 0.02
Further Details:      
 
Domain Number 2 Region: 124-185
Classification Level Classification E-value
Superfamily RING/U-box 8.25e-16
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075105   Gene: FBgn0036660   Transcript: FBtr0075346
Sequence length 608
Comment type=protein; loc=3L:complement(16770694..16771253,16771315..16772581); ID=FBpp0075105; name=CG13025-PA; parent=FBgn0036660,FBtr0075346; dbxref=FlyBase:FBpp0075105,FlyBase_Annotation_IDs:CG13025-PA,GB_protein:AAF49415.1,REFSEQ:NP_648919,GB_protein:AAF49415,FlyMine:FBpp0075105,modMine:FBpp0075105; MD5=0e5a09edbc10473e1f427d7845a82450; length=608; release=r5.30; species=Dmel;
Sequence
MENETEALDPEVYADETSTDDSSGDDEVILNPVEGLQPAVEIDEQRDQPGENAEPEQPRV
PPLILVDPPHLPSPPRNSRRNQGEEQEVISLETPSPPKKRKRLSAAADKSLKKSPEGKPI
VVDDEDDGMTCPICLDSWEMSGEHRLVSLRCGHLFGESCIRRWLNESHRQSSVKVCPQCK
TKATFRDIRHLYAKRIQMLDTDIREQLEAERRRTHTLTTELATAKLANTLTTEKLILLQK
DYERLKELVRAGGGRGAFGGDASGQKSIQQLATYRLYMEKNFEITRDPGCRVLLYSAKHS
MLVASQKSAQNLFPGYGVRFIDPPTFKPLQFLHTSALLIRDIAFSDSQHLLTVASRELKI
KIFDIRTRLCSSMFTAHDKMLWSCALDRNEREHFLYGGDLRGGVYIYDLRFPENILCEFQ
AEVNLSPVIHIAPVQPNKIFTSGGFLVCQLTALTFYEYAAASDTAVPTRLNVEGPFLSMQ
YDAVQDTVLISARSNPNFPQSRFILGRMDKIDGTPVLKVKATIYGSKATPVMTRPTQLAV
EDNTLVVGYLQDSKQLMMHDVRREERVQTMPVNEVIYDICPVATQAGSYLAALTDNKCRV
YKVNSSMR
Download sequence
Identical sequences Q9VV99
FBpp0075105 FBpp0075105 FBpp0305787 7227.FBpp0075105 NP_001261971.1.81976 NP_648919.1.81976 FBpp0075105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]