SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075360 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075360
Domain Number 1 Region: 366-698
Classification Level Classification E-value
Superfamily L domain-like 1.6e-50
Family Ngr ectodomain-like 0.0055
Further Details:      
 
Domain Number 2 Region: 209-446
Classification Level Classification E-value
Superfamily L domain-like 1.63e-47
Family Ngr ectodomain-like 0.0065
Further Details:      
 
Domain Number 3 Region: 1071-1214
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.88e-42
Family Toll/Interleukin receptor TIR domain 0.0000719
Further Details:      
 
Domain Number 4 Region: 810-950
Classification Level Classification E-value
Superfamily L domain-like 1.08e-31
Family Ngr ectodomain-like 0.0051
Further Details:      
 
Domain Number 5 Region: 45-275
Classification Level Classification E-value
Superfamily L domain-like 9.35e-22
Family Ngr ectodomain-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075360   Gene: FBgn0029114   Transcript: FBtr0075607
Sequence length 1346
Comment type=protein; loc=3L:15229221..15233261; ID=FBpp0075360; name=Tollo-PA; parent=FBgn0029114,FBtr0075607; dbxref=FlyBase:FBpp0075360,FlyBase_Annotation_IDs:CG6890-PA,GB_protein:AAF49650.1,REFSEQ:NP_524757,GB_protein:AAF49650,FlyMine:FBpp0075360,modMine:FBpp0075360; MD5=15a1eb1469a9b37999b9bf693bf65ec3; length=1346; release=r5.30; species=Dmel;
Sequence
MLATTHMLYVLIATCVIPIFGAALSKTVLYQAPDECRWSGGGEHDITLVCHLRTINSELE
NTNFSVIQPQNTVRLRLECNDALFFQSSLSPDSFRSLVELRDLTIEYCKLGNLTDGSFRG
LQELRNLTIRTHNGDWSTMSLEMASNSFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQH
LNASYNKIQDISNFYFSASLSSRKARVCGSTLQSLDLSANKMVSLPTAMLSALGRLTHLN
MAKNSMSFLADRAFEGLLSLRVVDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAPG
IFGELAELLVLDLASNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQI
LKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMD
QRSLVNCSQLQDLHLNDNKLQAVPEALAHVQLLKTLDVGENMISQIENTSITQLESLYGL
RMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRNSQLQAIRLDGNQLKSIAG
LFTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGNYFEIESELSLSTFDA
SYNLLTEITASSIPNSVEVLYLNDNQISKIQPYTFFKKPNLTRVDLVRNRLTTLEPNALR
LSPIAEDREIPEFYIGHNAYECDCNLDWLQKVNRESRTQPQLMDLDQIHCRLAYARGSSH
VSLIEAKSDDFLCKYASHCFALCHCCDFQACDCKMECPDRCSCYHDQSWTSNVVDCSRAS
YEQTLPSHIPMDSTQLYLDGNNFRELQSHAFIGRKRLKVLHLNHSRIEVLHNRTFYGLLE
LEVLQLQSNQLKALNGNEFQGLDNLQELYLQHNAIATIDTLTFTHLYHLKILRLDHNAIT
SFAVWNFLPSYLNELRLASNPWTCSCEFIDKLRDYINRHEYVVDKLKMKCDVISGNSTQQ
MVIYPGSGEPASLPVVQCSQTLPLGLDNNFNYAEQAGGENASNATSTKMILNQPPKLDYI
PILVAILTAFIFVMICISLVFIFRQEMRVWCHSRFGVRLFYNAQKDVDKNEREKLFDAFV
SYSSKDELFVNEELAPMLEMGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMVVSE
NFIKSEWCRFEFKSAHQSVLRDRRRRLIVIVLGEVPQKELDPDLRLYLKTNTYLQWGDKL
FWQKLRFALPDVSSSQRSNVAGQSCHVPINHASYHHHHHVHQQAMPLPHSVHHHQQQFML
PPPPQQPGSFRRQPSLHQQQQQQQQIRGNNNTTQQQQQQQAALLMGGGSVGGPAPQMIPL
AGGIQQQSLPLPPNQQPTPASRNLHM
Download sequence
Identical sequences Q9V477
FBpp0075360 7227.FBpp0075360 FBpp0075360 NP_524757.1.81976 FBpp0075360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]