SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075386 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075386
Domain Number 1 Region: 152-393,434-534,600-651
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.93e-124
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000367
Further Details:      
 
Domain Number 2 Region: 635-758
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.27e-34
Family Anticodon-binding domain of Class II aaRS 0.00024
Further Details:      
 
Domain Number 3 Region: 97-138
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000903
Family a tRNA synthase domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075386   Gene: FBgn0027088   Transcript: FBtr0075633
Sequence length 765
Comment type=protein; loc=3L:15088362..15090659; ID=FBpp0075386; name=Aats-gly-PB; parent=FBgn0027088,FBtr0075633; dbxref=FlyBase:FBpp0075386,FlyBase_Annotation_IDs:CG6778-PB,GB_protein:AAN11786.1,REFSEQ:NP_730022,GB_protein:AAN11786,FlyMine:FBpp0075386,modMine:FBpp0075386; MD5=43c3354cfb40236dbf6baf518fdd3292; length=765; release=r5.30; species=Dmel;
Sequence
MSLQLLKALPHLRSATTAVRTQIARTTWSEHIATKVFFSTTTTKPTPSAPPPPPPTQPQQ
PAATTSWGTKKQNRKVKLRSAAAEFIMSNPEIEAQLAPLRERVQEQGNLVRDLKAKGAPE
IDVKKAVAELKARKKLLEDKELALTPSVVSFDRAKMEDLLKRRFFYDQSFAIYGGITGQY
DFGPMGCALKSNILALWRQYFALEEQMLEVDCSILTPEPVLKASGHVERFADLMVKDVKT
GECFRLDHLIKQALEKLSKAKDATPALQAECEDIIIKLDGLNKQELAGVLAKYNIKSPLT
GNDLTEPIEFNLMFATQIGPTGLVKGFLRPETAQGIFVNFKRLLEFNQGKLPFAVAQIGN
SFRNEISPRSGLIRVREFTMAEIEHFCDPVLKDHPKFGNIKSEKLTLYSACNQMDGKSAA
QVQIGEAVASKLVANETLGYYMARIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCWDAE
ILTSYGWVECVGCADRSAYDLGQHTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALGKTF
KKEAKNITDALAKLSLEEITKVEEQLAGDGQYKLTTADGQSHDLGKDTISVKHSTKTVHV
EEFIPSVVEPSFGIGRIMYSLLEHSFQCRDGDEQRCYFTLPPLVAPIKCSILPLSNNTDF
QPYTQKLSSALTKAELSHKVDDSSGSIGRRYARTDEIAIPYGITVDFDTLKEPHTVTLRD
RNTMKQVRVGLEEVVGVVKDLSTARTTWESVTEQYPLFEQQEASK
Download sequence
Identical sequences Q9VUK8
FBpp0075386 NP_001261867.1.81976 NP_730022.1.81976 7227.FBpp0075386 FBpp0075386 FBpp0075386 FBpp0306062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]