SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0075495 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0075495
Domain Number 1 Region: 2253-2406
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-33
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00085
Further Details:      
 
Domain Number 2 Region: 2086-2226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-30
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00093
Further Details:      
 
Domain Number 3 Region: 1127-1187
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000343
Family ATI-like 0.043
Further Details:      
 
Domain Number 4 Region: 753-813
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000155
Family ATI-like 0.041
Further Details:      
 
Domain Number 5 Region: 2970-3030
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000932
Family ATI-like 0.059
Further Details:      
 
Domain Number 6 Region: 3637-3709
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000858
Family VWC domain 0.026
Further Details:      
 
Domain Number 7 Region: 1855-1915
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000165
Family Tachycitin 0.036
Further Details:      
 
Domain Number 8 Region: 196-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1247-1298
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000118
Family BSTI 0.056
Further Details:      
 
Weak hits

Sequence:  FBpp0075495
Domain Number - Region: 791-853
Classification Level Classification E-value
Superfamily FnI-like domain 0.000596
Family VWC domain 0.083
Further Details:      
 
Domain Number - Region: 292-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 2519-2552
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00128
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number - Region: 3312-3389
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00128
Family BSTI 0.064
Further Details:      
 
Domain Number - Region: 1298-1338
Classification Level Classification E-value
Superfamily FnI-like domain 0.00523
Family VWC domain 0.05
Further Details:      
 
Domain Number - Region: 1936-2007
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00572
Family BSTI 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075495   Gene: FBgn0029167   Transcript: FBtr0075753
Sequence length 3843
Comment type=protein; loc=3L:join(13839308..13839414,13839946..13840041,13840122..13840286,13840348..13840740,13840798..13840925,13840982..13841077,13841181..13841378,13841491..13841654,13841711..13841868,13841930..13842084,13842150..13842752,13842895..13844013,13844096..13844989,13845042..13845590,13845667..13846989,13847054..13847132,13847194..13847443,13847497..13848244,13848305..13848790,13848851..13849357,13849422..13849905,13849970..13851747,13851806..13852018,13852080..13852535,13852592..13852848,13852906..13853031); ID=FBpp0075495; name=Hml-PA; parent=FBgn0029167,FBtr0075753; dbxref=GB_protein:AAF49795.2,FlyBase:FBpp0075495,FlyBase_Annotation_IDs:CG7002-PA,REFSEQ:NP_524060,GB_protein:AAF49795,FlyMine:FBpp0075495,modMine:FBpp0075495; MD5=c3094dd96d4c2f80b7eff17c7e19be08; length=3843; release=r5.30; species=Dmel;
Sequence
MANKVIFVALWLLFISSVLTENGDIIITDDDDEDINPLLQAAPEVVDKENERNERHISFN
ILKAPAVSARYTYGGSEGGRSGFGGGYGVGGGGGGGYGGIKTSHAAGGLLTKTLGFLGMG
GQGSQGNFYGGGGHFLAAFGKCSALQLPSNVQSECHNGRCKVFCPTGYSFAQDVSVLEMF
CSNDGWIIGNSVFAEVPPCQAQCTPPCQNNGICISAGVCQCPENYYGPLCQQKKSICASF
PKAPKNSKVSCKNNMCHAECMRGFQFPDGSGITNIECRNGQWVHTKTGLSKTPDCAPTCA
PACQNGGQCISFNVCQCSKMFRGDHCQYNIDRCNVTNTNFNGNYKCAYEMDDARCTFSCP
QVPGLKIQGRIDIEYKCNYLQGQYLPAPLPKCIFPPGYTVRSTSSMQGVTHQNGVYHRGM
SGEMAYELQTERQKLLALLAKYRDLERRSEWWSSEETVVTMSSYSLYQSNNLDIVIDKTP
RPALCTTWGGINMKTFDGLVFKAPLSCSHTLITDKVSGTFDIILKACPYGSGYGCAHTLK
ILWQSVLYTFENLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHR
QYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVKAFADAWRVEDRSELCQVE
NSAEMEFGMDSCEQSKLQKAVSVCERLLANEKLGDCIKPFNYDALIRTCMADYCNCANRE
HPESCNCDAIAMLAKECAFKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLA
LPASKGACNEGCFCPEGTVQYKEACITRELCPCSLRGKEFKPESTVKKNCNTCTCKNGQW
RCTEDKCGARCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSESM
NFAAPDDPSCTKAVTIRFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLGEVLIRRA
SSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEGDVETA
VEPFADKWRTKDTCQFKAETHQGPHPCTLNPEKKAQAEKFCDWILQDIFQDCHFLVEPEQ
FYEDCLYDTCACKDEMSKCFCPILSAYGTECMRQGVKTGWRMSVKECAVKCPLGQVFDEC
GDGCALSCDDLPSKGSCKRECVEGCRCPHGEYVNEDGECVPKKMCHCNFDGMSFRPGYKE
VRPGEKFLDLCTCTDGVWDCQDAEPGDKDKYPPSSELRSKCAKQPYAEFTKCAPKEPKTC
KNMDKYVADSSDCLPGCVCMEGYVYDTSRLACVLPANCSCHHAGKSYDDGEKIKEDCNLC
ECRAGNWKCSKNGCESTCSVWGDSHFTTFDGHDFDFQGACDYVLAKGVFDNGDGFSITIQ
NVLCGTMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFH
IYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMG
LETSPMLFGHAWKLQPHCSAPVAPIDACKKHPERETWAQLKCGALKSDLFKECHAEVPLE
RFWKRCIFDTCACDQGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQCDPHCSDYK
ACTPACAVETCDNFLDQGIAERMCNRENCLEGCHIKPCEDGFIYLNDTYRDCVPKAECKP
VCMVRDGKTFYEGDITFTDSCATCRCSKRKEICSGVKCDVPATTGLPAPLVEGTTLPTPL
ATQNQTKCVKGWTRWCDKDRDTSDKSVRLNDEEKVPRYDRMENVYGTCLKQYMTKVECRV
KDTHEAPEQMDENVVCSLEEGLRCIGKCHDYELRAFCQCDEELEPELPKPTEKPQLGLAC
DAAVVEYKEFPGDCHKFLHCQPKGVEGGWIYVEKTCGEYMMFNPTMLICDHIATVTEIKP
NCGLKPEPEPEFEPIKQCPPGKIKSECANQCENTCHYYGSILKKRGLCQVGEHCKPGCVD
ELRPDCPKLGKFWRDEDTCVHADECPCMDKAEHYVQPHKPVLGEFEVCQCIDNAFTCVPN
KPEPVPKDEDDDLDLVSVVPIYPVTLTPPLQCSPERLIPKIENPAHSLPDSIFNASSQLA
PEHGPKMARLTKEQPRGSWSPSINDQMQYLELNFAKPEPFYGVVMAGSPEFDNYVTLFKI
LHSHDGIAYHYLVDETEKPQMFNGPLDSRAPVQTLFKIPIEASSLRIYPLKWHGSIAMRV
ELLICGDKEEPKPVPTVSTILPITERPARLVDLECIDLMGVDEGKMYQDQVQSSSLWQQP
NLGKKLQLLELLKLSTPLAWRPLANSQNEFIEFDFLEPRNISGFVTKGGPDGWVTGYKVM
FSKKKPTWNTVLSTDGQARIFEANHDAETERRHHFKNPILTQYIKIVPAYWEKNINMRIE
PLGCFLPYPEIQRQVPVEESKPTKCNICDGVSTSSSTTGCQCQDQLFWDGNTCVQHNLCP
CIENYVSYPIGSKFENSACEDCVCVLGGHKNCKPKKCPPCLGGKLRPVITSDCFCKCEPC
PKHQRLCPSSGDCIPEILWCNGVQDCADDEDASCSDSFTVEPDVSREKNETEVITCPVPV
CPPQMKIRITEKKSRKMSKMFTFSKQVSIVDDGTTITKTKFISSKEQILAMPNRELDFQL
EEQCDEFTCVPIPSKQVDKNETVTCTEPKCPEKYDVELDMSASKVGDCLRYSCVLRPNKD
DVCEISGKSFTTFDGTVFKYGPCSHILARDIHSSSWSISVHQQCSDETRKVCHKVITIQD
TEAGNELILLPHLKLKFNGYEFTVQQLINSPICKASFVVSQPGKTLLAVSTKYGFWVQLD
DIGIVKVGISSKFIRTVDGLCGYYNGNQKDDKRSPDGQIIPNTEKFGDSWYDKRIPKDQC
GDLKCPREMQAKALQLCNIIHHPTFARCHKAVNYKQFLNNYCLEAACNCMMANNGDPAAC
KCNILESFVKKCLSVNPLVQLTTWRAVAQCEINCPSPLVHTDCYKRRCEPSCDNVHGDDC
PVLPDACFPGCYCPEGTVRKGPNCVPISECKDCVCNSLGASKYMTYDRKSFSFNGNCTYL
LSRDVVLPGVHTFQVYVSMDDCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKS
LQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYG
SKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVIQSWQADEPKLGLVEECLSEDVPKEHCIP
LPPEKDPCLQFYNAELFGKCPLAVDPIAYVSACQQDICKPGNTQQGVCVALAAYAKECNQ
HGICTNWRRPQLCPYECPSDMVYEPCGCAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEM
CLSSERFEGCFCPPGKVMDGGQCVPEIACTKCDDGLHLPDEKWKKDKCTECQCDSKGKTT
CVEKKCQVEENICAEGYRPETIVSVDECCPRYRCVPETKDPSKLCLAPLVPICGPGQFKK
EKKDVNGCSQYICECIPKDQCEIIELRELLPGEIIVNVEEGCCPTQKIECKPETCPKAPV
NCQERFYEVKTIKEPGMCCSKHSCVPPKDLCIVQYELDEATKFTKTVGDKWTHAKEVCKQ
ETCSYGPDGNAQVVSTLEQCLTDCAPGFSYQNLDKTKCCGKCVQTSCIFEQKLYEVNALW
KSADNCTTYSCLKKDGQFLVTTSREVCPDVGSCLSHLLYQDGCCKRCKSEPLVEDKSSCL
PVSLAESRTKEILKFPVQGHGTCVNADPIQGFTDCEGACSSGSKYNTLTDMHEKFCTCCS
IKSYHPISVKMICDDGHTFTQKHEVPSNCGCSPCSEFSDSAIDVRMQQDAQSPLLQLLGN
HRH
Download sequence
Identical sequences Q9VU94
FBpp0075495 7227.FBpp0075495 NP_524060.2.81976 FBpp0075495 FBpp0075495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]