SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076111 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076111
Domain Number 1 Region: 847-893
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000363
Family Laminin-type module 0.0005
Further Details:      
 
Domain Number 2 Region: 956-1006
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 744-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000162
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 299-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000201
Family EGF-type module 0.094
Further Details:      
 
Domain Number 5 Region: 461-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 6 Region: 902-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Laminin-type module 0.0011
Further Details:      
 
Domain Number 7 Region: 414-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000215
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 799-849
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000105
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 9 Region: 359-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  FBpp0076111
Domain Number - Region: 1004-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000198
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 706-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000271
Family EGF-type module 0.093
Further Details:      
 
Domain Number - Region: 112-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00113
Family Galactose-binding domain 0.059
Further Details:      
 
Domain Number - Region: 1487-1618
Classification Level Classification E-value
Superfamily Tropomyosin 0.0209
Family Tropomyosin 0.02
Further Details:      
 
Domain Number - Region: 1292-1336
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0405
Family Cgl1923-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076111   Gene: FBgn0002528   Transcript: FBtr0076382
Sequence length 1639
Comment type=protein; loc=3L:join(9610347..9610541,9610879..9611012,9611076..9611203,9611270..9611884,9612401..9612812,9612879..9615464,9615523..9615859,9615917..9616217,9616279..9616490); ID=FBpp0076111; name=LanB2-PA; parent=FBgn0002528,FBtr0076382; dbxref=FlyBase:FBpp0076111,FlyBase_Annotation_IDs:CG3322-PA,GB_protein:AAF50238.1,REFSEQ:NP_524006,GB_protein:AAF50238,FlyMine:FBpp0076111,modMine:FBpp0076111; MD5=1774e24ee266e878b7db0845823564fb; length=1639; release=r5.30; species=Dmel;
Sequence
MKRSRWSHSGSSTARLLLIGVLFASCSTAILGAQRPPINSAGGHELRGTTFMPALECYDP
YGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFCIQTMNQNHKNCEFCKYNDHNPSFLT
DLHDPQSPTWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTS
ESGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEG
RPSGINFERSGELQEWVTATDIRITLDRLNTFGDELFGDSQVLKSYFYAISDIAVGARCK
CNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACN
CNGLADKCFFDANLFNRTGHGGHCLDCRENRDGPNCERCKENFYMRDDGYCVNCACDPVG
SRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHQNTPACDTETG
ICFCKENVEGRRCNECKPGFFNLDKNNRFGCTPCFCYGHTSECMTAPGYSIVSVTSNFNK
FKERWTAADLNQREVDIKYNQYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFKL
QLVGQVANTGVSDVILEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHEHHDYQWQPSQSA
RGFLSILSNLTAIKIRATYSVQGEAILDDVELQTAHRGAAGHPATWIEQCTCPEGYLGQF
CESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTHGDNCDQCAKGFYG
NALGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFFGDPTGLLGE
VQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCD
RCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDP
VGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKGFQCDQNG
QCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDAADLHRAKLFNLSQTLDEIAR
TPVTNDDEFEAKLKAVQEKVAVLAQDARDNSGDGGQTYAEVIDDLHKHLDSVREHLVSAD
KFQADANGEIDRARQNYTILDQITENAKKELQQALDLLNDEGAQALARAKEKSVEFGQQS
EQISDISREARALADKLESEAQFDLKNAKDAKDAVEKAHQLAKSAIDLQLKIGTELRSEV
GLELSHVKQSLGTVVQTSKEALRKANEVYDTALTLLNDVNRQTQPEIDISQLKKDAVAAN
ERADELLKQITELSNSNGELFADFETEQELTEALLKRAEQQQLEDIELLERAKAAHDKAT
KAVEQGDNTLKEANNTYEKLAGFQSDVQRSSESAEKALQTVPNIEKEIQNAESLISQAEE
ALDGANKNANEAKKNAQEAQLKYAEQASKDAELIRRKANETKVAARNLREEADQLNHRVK
LTEMDIFKLEESSTKDDNLVDDAKRKVGQAKADTQEAQKQIEKANADLTAIKDELENLKD
INTGDLDRLENRLATVEGEINRVNLTGRIEKYREQRTIQKNLIDKYDAELRELKDEVQNI
GLISKALPDSCFSRNRLEP
Download sequence
Identical sequences P15215 X2JAW6
FBpp0076111 FBpp0076111 NP_001287009.1.81976 NP_524006.1.81976 FR379 FBpp0076111 7227.FBpp0076111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]