SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076265 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076265
Domain Number 1 Region: 9-116
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.33e-23
Family Canonical RBD 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076265   Gene: FBgn0011206   Transcript: FBtr0076538
Sequence length 228
Comment type=protein; loc=3L:complement(9095786..9095907,9100442..9100475,9100719..9100795,9101056..9101173,9101232..9101291,9105734..9105887,9106146..9106267); ID=FBpp0076265; name=bol-PB; parent=FBgn0011206,FBtr0076538; dbxref=FlyBase:FBpp0076265,FlyBase_Annotation_IDs:CG4760-PB,GB_protein:AAF50317.3,REFSEQ:NP_523989,GB_protein:AAF50317,FlyMine:FBpp0076265,modMine:FBpp0076265; MD5=aa4239b29fc9cf83015cc89eee1b3124; length=228; release=r5.30; species=Dmel;
Sequence
MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVK
STKIIVDRAGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQPNPLQSIV
ATNGAVYYTTTPPAPISNIPMDQFAAAVYPPAAGVPAIYPPSAMQYQPFYQYYSVPMNVP
TIWPQNYQENHSPLLHSPTSNPHSPHSQSHPQSPCWSIEDLRDTLPRV
Download sequence
Identical sequences A4V1Q0 Q24207
NP_001286992.1.81976 NP_523989.1.81976 NP_729456.1.81976 FBpp0076265 7227.FBpp0076267 FBpp0076265 FBpp0076267 FBpp0076265 FBpp0076267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]