SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0076790 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0076790
Domain Number 1 Region: 459-553
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000343
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 565-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000174
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0076790   Gene: FBgn0003984   Transcript: FBtr0077082
Sequence length 623
Comment type=protein; loc=3L:complement(5807915..5807966,5809747..5809800,5810635..5810743,5810998..5811125,5811209..5811386,5835308..5836658); ID=FBpp0076790; name=vn-PA; parent=FBgn0003984,FBtr0077082; dbxref=FlyBase_Annotation_IDs:CG10491-PA,FlyBase:FBpp0076790,GB_protein:AAF50739.2,REFSEQ:NP_523942,GB_protein:AAF50739,FlyMine:FBpp0076790,modMine:FBpp0076790; MD5=82df6a2a85e70db36b6196dcbfc53541; length=623; release=r5.30; species=Dmel;
Sequence
MYAQHLRKWSLKTKKQLMPLILLIISYMLLLNTCVLSSSATTQQQQQQQQQQQHLPRLWE
GSAEESSYYIPLSSDNGSGSSESSAESGSSSSRSSSNNIDNNILSRLLSLNSNSLSSRSN
VKLKPATVFDAGSSTPAQQEQHVAAVPEQQQQQQQQQQSMQKVPNTLINSQIYNLLYNGM
PSEAASSKMRRHIQPSQLPHQPESRAQLPSNYSSRPAVRSYLIESYEMPESMLEDRSPEQ
AARSRRDGSNTNGSRQQQRTGHRQQLQQDKRDHRRQRQDQQKEQRQQQQQRQHKSGNKHQ
QQQQQRRKHQRKHQRYNRYCSARDPAQLAFAAPTVFQGVFKSMSADRRVNFSATMKVEKV
YKQQHDLQLPTLVRLQFALSNSSGECDIYRERLMPRGMLRSGNDLQQASDISYMMFVQQT
NPGNFTILGQPMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAIIKHGKKLRIVCEV
SGQPPPKVTWFKDEKSINRKRNIYQFKHHKRRSELIVRSFNSSSDAGRYECRAKNKASKA
IAKRRIMIKASPVHFPTDRSASGIPCNFDYCFHNGTCRMIPDINEVYCRCPTEYFGNRCE
NKWPDSRYFVAIYGQIHTLNNDY
Download sequence
Identical sequences Q94918
FBpp0076790 NP_523942.2.81976 7227.FBpp0076790 FBpp0076790 FBpp0076790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]