The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0077082 |
| Domain Number 1 |
Region: 75-142 |
| Classification Level |
Classification |
E-value |
| Superfamily |
SAM/Pointed domain |
0.000000000000513 |
| Family |
SAM (sterile alpha motif) domain |
0.061 |
| Further Details: |
|
| |
| Sequence: |
FBpp0077082 |
| Domain Number - |
Region: 149-218 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Chemotaxis receptor methyltransferase CheR, N-terminal domain |
0.000471 |
| Family |
Chemotaxis receptor methyltransferase CheR, N-terminal domain |
0.011 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Biological Process |
IC (bits) |
H-Score |
| Cellular Component |
IC (bits) |
H-Score |
| Molecular Function |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0077082 Gene: FBgn0031644 Transcript: FBtr0077390 |
| Sequence length |
349 |
| Comment |
type=protein; loc=2L:join(4890077..4890367,4890429..4891187); ID=FBpp0077082; name=CG15625-PA; parent=FBgn0031644,FBtr0077390; dbxref=FlyBase:FBpp0077082,FlyBase_Annotation_IDs:CG15625-PA,GB_protein:AAF50964.1,REFSEQ:NP_608872,GB_protein:AAF50964,FlyMine:FBpp0077082,modMine:FBpp0077082; MD5=64f5437f16bd831a163a84745fcab28a; length=349; release=r5.30; species=Dmel; |
| Sequence |
MPYLYGIADTKFLHQKVKKKTKIRSDMAPTKFQRNEFLKGCPKYDGDDIPIQFRTTPDSL
VELSIIVVDKLPLPSIFEWDDMDIRRWINGYGYPQYMNTFRVNMITGRKLLLLDASALCA
MNIKNFDHIRHISYGIRMLFHFELTKFSSSISLPDEKPNELYLLFHTQTGVNYDEVRRSD
LYRRMQMLRERARNLDHWDLLYLWLRHEQERKYKELIGMVPRFTMYKCEEAAKPPEEPED
MEPEELMCMTCIPPCDCDWTARDLRLPWRLECLPPMLETTMSKWNALQAQCSTCIPPCEC
RWPPRFYLTGTVIRCLQQRFPEKFCPIFDERYRASPRPSLVERWTRFSI
|
| Download sequence |
 |
| Identical sequences |
Q9VR43
FBpp0077082 FBpp0077082 FBpp0077082 NP_608872.1.81976 7227.FBpp0077082 |
