SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077193 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077193
Domain Number 1 Region: 11-228
Classification Level Classification E-value
Superfamily L domain-like 7.14e-32
Family Internalin LRR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077193   Gene: FBgn0031575   Transcript: FBtr0077504
Sequence length 806
Comment type=protein; loc=2L:join(3867982..3867988,3868380..3868540,3868604..3869061,3869118..3869476,3869543..3869803,3869873..3870049,3870125..3870554,3870622..3871189); ID=FBpp0077193; name=Cep97-PB; parent=FBgn0031575,FBtr0077504; dbxref=FlyBase:FBpp0077193,FlyBase_Annotation_IDs:CG3980-PB,GB_protein:AAF51055.2,GB_protein:AAF51055.3,REFSEQ:NP_608811,GB_protein:AAF51055,FlyMine:FBpp0077193,modMine:FBpp0077193; MD5=436b86863bf94a4caf931a959451f1ce; length=806; release=r5.30; species=Dmel;
Sequence
MSGDESGEEKHVLNLSKQKLKKVPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLA
RNQLLRMYGVCRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNL
ECLNLADNSIGSISDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLN
EICTLSHLSNLLSISIADNPCVTMINSLDGFDYRPFVLNWCMSLKYIDGFVVDPIESLKA
EWLYSQGRGRQFRVGEQQGLAKYLSSVCPLVGKALENENDRKLRLILSKAQHHQRQLQEE
IMDNANSSASTSPSSHRKKPTSRIQSPRFSRLSGRQGSPESMVNSYHGNSSNNSIVSDNG
STNHSLQMSISLIENIKNDGEGFSLAGSGMSSSVTTKTYNSTESTPRNITPNPYNDQTFI
SQTPSGGPLAAASKMVPVPETLMSPDVCPAAVAQRVTVTALNPQLHKTKINKNKDNKLNL
PRVRSPQLKRNQSPTSSPRRMANKCSADNMQAPEKLQQSAVLADSGGFSTDDDGEQINIE
KLRAIRKMAAQKQQQMHQEQLKQQVDNNLNCQDRLIEHVTESSAVTIQKMWRGYHTRKKT
NKDIAERLQRRRTQEYIEQLGKDMLLTKAQLENERKIQQLQMQAINALWKKVSTMEVDPK
GIPAAAEQGEDSNGGGSGHLSLDQNSAAVVNDLAKRCTMLTDQVQMLQSSIGTIVNCLTM
VCNLPQDAIKKQAEIIDCSSTQTDLIAVHTPQIEDLTNFPFTKTRPSTLALESKHEAALA
CPKIDELNDVDLKETQEDSENLDKDP
Download sequence
Identical sequences Q9VQV7
FBpp0077193 FBpp0077193 NP_608811.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]