SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077310 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077310
Domain Number 1 Region: 389-447
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000003
Family Variant RING domain 0.0081
Further Details:      
 
Weak hits

Sequence:  FBpp0077310
Domain Number - Region: 46-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000858
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077310   Gene: FBgn0031474   Transcript: FBtr0077625
Sequence length 562
Comment type=protein; loc=2L:join(2864984..2865418,2865482..2865577,2866332..2866741,2866814..2867230,2867337..2867667); ID=FBpp0077310; name=CG2991-PA; parent=FBgn0031474,FBtr0077625; dbxref=FlyBase_Annotation_IDs:CG2991-PA,FlyBase:FBpp0077310,GB_protein:AAF51189.1,REFSEQ:NP_722856,GB_protein:AAF51189; MD5=8caa79f1b644e2dec85c60c1ffaade00; length=562; release=r5.30; species=Dmel;
Sequence
MLPSLDTLMRCSKRVLQSPLEAAASQMRNGHSKSAAGGIYGPFTPDNDLSCSGRGDCVNN
TCVCDIRYAGNECDIFNLPYYAGISTVFYVVALVSVIQLLICIVAEYQRLKQPSVLRACR
ITTQKLLYFMVFVAASLRGAYFTTPLDLQPQWAVTLMSAYYPLLMTCASLIVCMWAEIFH
LRDIRWEKSQFLSKSFLGFVAFNFFLYSLFGIEVFNSLINAERRDYAHIFNGCYAVLLLI
VVVFFLIYGVEVFFKLRGGFVYDQTGKILGPSEAIVNASQLHQSRFGLLFQAVMLIVIVG
FLTSETLGDFWKTKVPVNSRNWHDIIFRIAEIGVALWFPCCLWNSMAPEQLWILNPRKLL
SRQIDPSIPTLNAETNKLSPEEGQSFLTKKDCWICYDSDKPEPLIQPCRCTGDVSSVHHE
CLKRWLVESCSNSEAQLSCKVCGHPYEIEKSKKLEWDKGFTIQHWSKTVILITLMCVTGA
TAWVVIQMYVDPLVRVMTVGIAVLIGYVCVKCLGENTVVAYQRAKVSSINIVTSSEMEKL
HTICEEVSASTSAEAVRAGAAS
Download sequence
Identical sequences B4Q8M2 Q9VQI2
FBpp0077310 FBpp0077311 FBpp0077312 7227.FBpp0077310 FBpp0077310 FBpp0221591 FBpp0077310 FBpp0077311 FBpp0077312 NP_608725.1.81976 NP_722856.1.81976 NP_722857.1.81976 XP_016023199.1.80810 XP_016023200.1.80810 XP_016023201.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]