SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0077791 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0077791
Domain Number 1 Region: 22-128
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-28
Family SH2 domain 0.0000547
Further Details:      
 
Domain Number 2 Region: 329-431
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-22
Family SH2 domain 0.0000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0077791   Gene: FBgn0020622   Transcript: FBtr0078132
Sequence length 506
Comment type=protein; loc=2L:join(298403..298403,299033..299918,302026..302659); ID=FBpp0077791; name=Pi3K21B-PA; parent=FBgn0020622,FBtr0078132; dbxref=FlyBase:FBpp0077791,FlyBase_Annotation_IDs:CG2699-PA,GB_protein:AAF51510.2,REFSEQ:NP_477270,GB_protein:AAF51510,FlyMine:FBpp0077791,modMine:FBpp0077791; MD5=e2b8a06e02cbc1b27029f16cb23aef7c; length=506; release=r5.30; species=Dmel;
Sequence
MQPSPLHYSTMRPQAPGSLVDPNEDELRMAPWYWGRISREEAKSILHGKPDGSFLVRDAL
SMKGEYTLTLMKDGCEKLIKICHMDRKYGFIETDLFNSVVEMINYYKENSLSMYNKTLDI
TLSNPIVRAREDEESQPHGDLCLLSNEFIRTCQLLQNLEQNLENKRNSFNAIREELQEKK
LHQSVFGNTEKIFRNQIKLNESFMKAPADAPSTEAGGAGDGANAAASAAANANARRSLQE
HKQTLLNLLDALQAKGQVLNHYMENKKKEELLLERQINALKPELQILQLRKDKYIERLKG
FNLKDDDLKMILQMGFDKWQQLYETVSNQPHSNEALWLLKDAKRRNAEEMLKGAPSGTFL
IRARDAGHYALSIACKNIVQHCLIYETSTGFGFAAPYNIYATLKSLVEHYANNSLEEHND
TLTTTLRWPVLYWKNNPLQVQMIQLQEEMDLEYEQAATLRPPPMMGSSAPIPTSRSREHD
VVDGTGSLEAEAAPASISPSNFSTSQ
Download sequence
Identical sequences O18683
FBpp0077791 FBpp0077791 7227.FBpp0077791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]